Recombinant Arabidopsis thaliana Alternative oxidase 1c, mitochondrial (AOX1C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your requirements; we will prioritize your request whenever possible.
Synonyms
AOX1C; At3g27620; MGF10.3; Ubiquinol oxidase 1c, mitochondrial; Alternative oxidase 1c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
46-329
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
AOX1C
Target Protein Sequence
SKMTFEKKKTSEEEEGSGDGVKVNDQGNKGEQLIVSYWGVKPMKITKEDGTEWKWSCFRP WETYKADLTIDLKKHHVPSTLPDKIAYWMVKSLRWPTDLFFQRRYGCRAIMLETVAAVPG MVGGMLMHFKSLRRFEQSGGWIKALLEEAENERMHLMTFMEVAKPKWYERALVISVQGVF FNAYLIGYIISPKFAHRMVGYLEEEAIHSYTEFLKELDNGNIENVPAPAIAVDYWRLEAD ATLRDVVMVVRADEAHHRDVNHYASDIHYQGHELKEAPAPIGYH
Uniprot No.

Target Background

Function
Recombinant *Arabidopsis thaliana* Alternative oxidase 1c (AOX1C), a mitochondrial enzyme, catalyzes the cyanide-resistant oxidation of ubiquinol and the reduction of molecular oxygen to water. Unlike other oxidases, AOX1C does not translocate protons and is therefore uncoupled from oxidative phosphorylation. Its activity may increase respiration under conditions of cytochrome pathway restriction or low temperatures.
Gene References Into Functions
  1. AOX1C activation by Tricarboxylic acid cycle intermediates. PMID: 29208641
Database Links

KEGG: ath:AT3G27620

STRING: 3702.AT3G27620.1

UniGene: At.42928

Protein Families
Alternative oxidase family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein. Note=Mitochondrial, possibly in the inner surface of the inner mitochondrial membrane.
Tissue Specificity
Expressed in roots, stems, leaves, cotyledons and flowers. High expression in stamens.

Q&A

What is the genomic organization of AOX1C and how does it compare to other AOX isoforms in Arabidopsis thaliana?

AOX1C is one of five AOX genes in Arabidopsis thaliana, which include AOX1A-D and AOX2. These isoforms, while related, have distinct genomic structures and expression patterns. AOX1C is part of the AOX1 subfamily, which represents the majority of plant AOX genes. Unlike some other isoforms that show significant upregulation during stress (particularly AOX1A), each isoform appears to have specialized functions and cannot fully compensate for each other's roles even under stress conditions . For researchers working with AOX1C, it's important to note that T-DNA insertion lines (CS804611, CS877307) are available from the Arabidopsis Biological Resource Center (ABRC) for functional analysis .

What are the basic expression patterns of AOX1C in different tissues and developmental stages?

While detailed AOX1C-specific expression data is limited in the provided literature, AOX isoforms generally show tissue-specific and developmental stage-specific expression patterns. To investigate AOX1C expression patterns, researchers should consider generating promoter-reporter constructs (such as proAOX1C::GUS) similar to those developed for other AOX isoforms . This approach allows visualization of expression patterns across tissues and developmental stages. Expression analysis should be conducted using quantitative RT-PCR with AOX1C-specific primers designed to avoid cross-amplification with other AOX isoforms.

How do I isolate and purify recombinant AOX1C protein for biochemical studies?

The isolation and purification of recombinant AOX1C should follow protocols similar to those established for AOX1A, with modifications to account for potential differences in protein properties:

  • Clone the cDNA of AOX1C coding for the mature protein (without mitochondrial targeting sequence)

  • Insert the coding sequence into an expression vector (such as pET28a) with a suitable tag (e.g., His-tag)

  • Transform the construct into an expression host (E. coli BL21(DE3) has proven effective for AOX1A)

  • Induce protein expression with IPTG

  • Purify using affinity chromatography

  • Confirm identity by Western blotting and mass spectrometry (MALDI-TOF-TOF)

Researchers should ensure that the recombinant AOX1C retains functional activity by measuring oxygen uptake, which should be in the range of several μmol min⁻¹ mg⁻¹ protein for active AOX proteins .

What structural features distinguish AOX1C from other Arabidopsis AOX isoforms?

While the crystal structure of plant AOX proteins remains unresolved, structural insights can be gained through biophysical characterization and comparative analysis. For AOX1A, circular dichroism (CD) studies have revealed that >50% of the protein content is α-helical, maintaining structural integrity across a wide range of temperature and pH conditions .

To characterize AOX1C structure:

  • Perform CD spectroscopy to determine secondary structure elements

  • Assess thermal and pH stability

  • Use homology modeling based on the resolved structures of other di-iron carboxylate proteins

  • Conduct in silico structural analysis to identify functional domains and binding sites

Key regions of interest would include the hydrophobic binding groove (corresponding to Met191, Val192, Met195, Leu196, Phe251, and Phe255 in AOX1A) and regulatory sites like the Cys II region (Arg174, Tyr175, Gly176, Cys177, Val232, Ala233, Asn294, and Leu313 in AOX1A) .

How do inhibitors and activators interact with AOX1C compared to other AOX isoforms?

Based on studies with AOX1A, inhibitors such as salicylhydroxamic acid (SHAM) and n-propyl gallate (n-PG) bind reversibly to the protein at a hydrophobic groove that also accommodates quinones. For AOX1C research, consider:

  • Performing binding assays with common AOX inhibitors (SHAM, n-PG)

  • Using surface plasmon resonance (SPR) to determine binding kinetics and affinity

  • Conducting docking studies to identify potential binding pockets

  • Creating site-directed mutants to confirm key residues involved in inhibitor binding

For activator interactions, study pyruvate binding to the regulatory Cys II pocket. The table below compares expected binding sites based on AOX1A data:

CompoundExpected Binding Region in AOX1CKey Residues (based on AOX1A homology)Binding Characteristics
SHAM/n-PGHydrophobic grooveMet, Val, Phe residues (equivalent to Met195, Phe255 in AOX1A)Reversible binding
PyruvateCys II pocketArg, Gly, Cys residues (equivalent to Arg174, Gly176, Cys177 in AOX1A)Regulatory activation
DuroquinoneHydrophobic grooveSimilar to inhibitor binding siteSubstrate interaction

What role does AOX1C play in carbon and nitrogen metabolism during stress conditions?

While specific AOX1C functions in C/N metabolism aren't detailed in the search results, AOX proteins generally play crucial roles in maintaining metabolic balance during stress. AOX1A significantly influences photosynthetic capacity and C/N assimilation during nitrogen limitation . To investigate AOX1C's role:

  • Generate and characterize aox1c single mutants and multiple mutants (aox1c/aox1a, etc.)

  • Assess mutant phenotypes under various stress conditions, particularly low nitrogen

  • Measure key physiological parameters (photosynthetic rate, electron transport rate, PSII efficiency)

  • Analyze C/N ratios in different tissues

  • Perform transcriptomic analysis to identify differentially expressed genes related to C/N metabolism

What expression systems are most suitable for producing functional recombinant AOX1C?

  • Test different expression vectors (pET28a shown effective for AOX1A)

  • Optimize induction conditions (IPTG concentration, temperature, duration)

  • Consider codon optimization for E. coli if expression levels are low

  • For challenging expression, explore alternative systems like insect cells or yeast

Key validation steps include:

  • Confirm expression by SDS-PAGE (~37 kDa expected for AOX proteins with tags)

  • Verify identity by Western blotting and mass spectrometry

  • Test functionality through oxygen uptake measurements

  • Assess sensitivity to AOX inhibitors

How should I design experiments to study the functional redundancy between AOX1C and other AOX isoforms?

Understanding functional redundancy requires systematic genetic and biochemical approaches:

  • Generate single, double, and higher-order mutants of AOX genes

    • Use available T-DNA insertion lines (CS804611, CS877307 for aox1c)

    • Confirm knockout status via PCR and RT-PCR

  • Create complementation lines

    • Clone the genomic DNA sequence of AOX1C with its native promoter

    • Transform into corresponding mutant backgrounds

    • Select transformants and confirm expression levels

  • Analyze phenotypes under multiple conditions:

    • Normal growth conditions

    • Abiotic stresses (drought, temperature, high light)

    • Biotic stresses (pathogens)

    • Respiratory inhibitor treatments (antimycin A, cyanide)

    • Nutrient limitations (especially nitrogen)

  • Compare physiological parameters across genotypes:

    • Growth rates and morphology

    • Photosynthetic parameters

    • Respiratory rates

    • ROS production

    • Stress tolerance markers

What protocols should I follow to investigate the post-translational regulation of AOX1C?

AOX proteins undergo complex post-translational regulation, including:

  • Redox regulation through disulfide bond formation/reduction

  • Dimerization through non-covalent interactions

  • Activation by α-keto acids like pyruvate via thiohemiacetal linkage

To study these processes in AOX1C:

  • For redox regulation:

    • Use non-reducing vs. reducing SDS-PAGE to visualize different oxidation states

    • Generate Cys mutants to identify essential regulatory cysteines

    • Test the effects of reducing agents (DTT) and oxidizing agents

  • For α-keto acid regulation:

    • Measure oxygen consumption with/without pyruvate

    • Perform binding studies using isothermal titration calorimetry or SPR

    • Create site-directed mutants of predicted regulatory residues

  • For protein-protein interactions:

    • Use blue native PAGE to visualize protein complexes

    • Perform co-immunoprecipitation studies

    • Consider advanced techniques like FRET or BiFC for in vivo interaction studies

How do I reconcile contradictory findings about AOX1C function in different experimental systems?

Researchers often encounter contradictory results when studying AOX proteins due to differences in:

  • Experimental conditions:

    • Growth conditions (light intensity, photoperiod, temperature)

    • Nutrient availability (particularly nitrogen levels)

    • Developmental stage of plants

    • Duration and intensity of stress treatments

  • Genetic backgrounds:

    • Ecotype differences (Col-0 vs. others)

    • Presence of unintended mutations in transgenic lines

    • Different T-DNA insertion positions for the same gene

To resolve contradictions:

  • Directly compare experimental conditions by replicating published protocols

  • Use multiple independent mutant or transgenic lines

  • Perform complementation studies to confirm phenotypes are due to the specific gene

  • Consider genetic redundancy by examining expression of other AOX genes in your system

  • Use quantitative measurements rather than qualitative observations whenever possible

  • Analyze dose-dependency and time-course responses

What methods are most reliable for measuring AOX1C activity in mitochondrial preparations?

For accurate measurement of AOX activity:

  • Isolate intact, functional mitochondria from plant tissues

  • Measure oxygen consumption using:

    • Clark-type oxygen electrode

    • Optical oxygen sensors

    • High-resolution respirometry

  • Use specific inhibitors to distinguish AOX activity:

    • Inhibit Complex III with antimycin A or myxothiazol

    • Inhibit Complex IV with cyanide (KCN)

    • AOX-dependent respiration is the oxygen consumption resistant to these inhibitors but sensitive to AOX inhibitors (SHAM, n-PG)

  • Calculate key parameters:

    • Alternative pathway capacity

    • Contribution to total respiration

    • Response to activators like pyruvate

  • Consider the following potential sources of error:

    • Mitochondrial integrity during isolation

    • Non-specific effects of inhibitors

    • Background oxygen consumption

    • Sample-to-sample variation

Expected AOX activity in non-thermogenic plants is approximately 3-4 μmol min⁻¹ mg⁻¹ protein under optimal conditions .

How should I analyze RNA-seq data to identify genes co-regulated with AOX1C during stress responses?

RNA-seq analysis for AOX1C co-regulation requires:

  • Experimental design considerations:

    • Include multiple time points to capture dynamic responses

    • Compare wild-type, aox1c mutants, and complementation lines

    • Include relevant stress conditions and controls

  • Bioinformatic analysis pipeline:

    • Quality control and read trimming

    • Alignment to the Arabidopsis genome

    • Quantification of gene expression

    • Differential expression analysis

    • Gene Ontology enrichment

  • Co-expression analysis:

    • Generate correlation matrices

    • Perform hierarchical clustering

    • Use weighted gene co-expression network analysis (WGCNA)

    • Identify modules of co-regulated genes

  • Validation approaches:

    • qRT-PCR confirmation of selected genes

    • Promoter motif analysis to identify common regulatory elements

    • Cross-reference with publicly available datasets

    • Functional analysis of key co-regulated genes

Focus particularly on genes involved in photosynthesis, respiration, and C/N metabolism, as these pathways are known to be influenced by AOX activity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.