Recombinant Arabidopsis thaliana Alternative oxidase 2, mitochondrial (AOX2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
AOX2; At5g64210; MSJ1.5; Ubiquinol oxidase 2, mitochondrial; Alternative oxidase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-353
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
AOX2
Target Protein Sequence
NMFVSSVSSTSVMKSPYEITAPMRIHDWCGGFGDFKIGSKHVQGNFNLRWMGMSSASAME KKDENLTVKKGQNGGGSVAVPSYWGIETAKMKITRKDGSDWPWNCFMPWETYQANLSIDL KKHHVPKNIADKVAYRIVKLLRIPTDIFFQRRYGCRAMMLETVAAVPGMVGGMLLHLKSI RKFEHSGGWIKALLEEAENERMHLMTMMELVKPKWYERLLVMLVQGIFFNSFFVCYVISP RLAHRVVGYLEEEAIHSYTEFLKDIDNGKIENVAAPAIAIDYWRLPKDATLKDVVTVIRA DEAHHRDVNHFASDIRNQGKELREAAAPIGYH
Uniprot No.

Target Background

Function

This recombinant Arabidopsis thaliana Alternative oxidase 2, mitochondrial (AOX2) catalyzes the cyanide-resistant oxidation of ubiquinol and the reduction of molecular oxygen to water. Unlike other oxidases, it does not translocate protons and is therefore uncoupled from oxidative phosphorylation. AOX2 may enhance respiration under conditions of cytochrome pathway restriction or low temperatures.

Database Links

KEGG: ath:AT5G64210

STRING: 3702.AT5G64210.1

UniGene: At.55697

Protein Families
Alternative oxidase family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein. Note=Mitochondrial, possibly in the inner surface of the inner mitochondrial membrane.
Tissue Specificity
Maximally expressed in dry seeds. Detected in roots, stems and leaves.

Q&A

Basic Research Questions

  • What is the expression pattern of AOX2 during seed germination?

    AOX2 shows a distinct temporal expression pattern during seed germination. Northern blot analysis reveals that AOX2 mRNA is already abundant in dry seeds (0 hours), reaches maximum levels around 12 hours after imbibition, maintains high levels up to 48 hours, and subsequently decreases . This contrasts with AOX1a, which shows less abundant mRNA accumulation from 0-48 hours after imbibition and then increases . This expression pattern suggests that AOX2 plays a crucial role in the early stages of germination, while AOX1a becomes more important in later stages .

  • How does the gene structure of AOX2 differ from other AOX isoforms?

    AOX2 has a unique gene structure compared to other AOX genes. While most plant AOX genes consist of four exons and three introns, 5'RACE analysis reveals that AOX2 contains five exons and four introns . This additional exon is located in the upstream region of the gene and contains the information for the N-terminal extension that may contribute to its unique targeting properties . This structural difference may explain some of the functional divergence between AOX2 and other AOX isoforms.

  • What are the functions of mitochondrial AOX2 in Arabidopsis thaliana?

    In mitochondria, AOX2 functions as part of the alternative respiratory pathway, which bypasses complexes III and IV of the electron transport chain. During seed germination, both cytochrome and alternative respiratory pathways increase in capacity . The alternative pathway involving AOX2 contributes to:

    • Regulation of redox balance during early germination

    • Protection against respiratory inhibitors like antimycin A

    • Modulation of ROS (reactive oxygen species) production in germinating seeds

    The increase in alternative pathway capacity appears dependent on the expression of both AOX2 and AOX1a, suggesting complementary roles during germination .

  • What techniques are used to study AOX2 subcellular localization?

    Several techniques are employed to determine AOX2 subcellular localization:

    • Fusion with GFP (Green Fluorescent Protein): AOX2 can be fused with GFP at either N or C terminus to visualize its localization in vivo

    • Mitochondrial staining with MitoTracker Orange: Used in conjunction with GFP fusion to confirm mitochondrial localization

    • Computational prediction using PSORT: This program predicts sorting signals and suggests that AOX2 contains a cleavable mitochondrial targeting signal that can form an amphiphilic α-helical structure

    • Chloroplast targeting studies: Using RbcS transit peptide fusions to examine potential chloroplast localization

Advanced Research Questions

  • How does AOX2 contribute to salt stress tolerance during seed germination?

    AOX2 plays a critical role in salt stress tolerance during germination through several mechanisms:

    • AOX2 transcript is significantly upregulated under ABA, NaCl, H₂O₂, PEG6000, or mannitol treatments during seed germination

    • Compared to wild-type, seed germination and greening are delayed in aox2 mutants under NaCl treatment but enhanced in AOX2 overexpression lines

    • AOX2 influences ABA signaling: The aox2 mutant shows upregulation of genes related to ABA biosynthesis and signal transduction under salt stress, resulting in higher ABA levels

    • ROS homeostasis: ROS primarily produced from root tip mitochondria of germinated seeds accumulate more in aox2 mutants than in wild-type plants. Exogenous ascorbic acid (AsA) decreases ROS levels and rescues the salt-hypersensitive phenotypes of aox2

    • AOX2 expression under salt stress requires ABI3 and ABI4 transcription factors, which interact with the AOX2 promoter

  • What evidence supports the dual targeting of AOX2 to both mitochondria and chloroplasts?

    Several lines of evidence support the dual targeting capability of AOX2:

    • Suppression studies: Overexpression of AOX2 rescues the variegation phenotype of the immutans (im) mutant, which lacks PTOX (plastid terminal oxidase)

    • Functional complementation: AOX2 can functionally replace PTOX activity in the desaturation steps of carotenogenesis in chloroplasts

    • N-terminal sequence analysis: AOX2 contains an N-terminal sequence that allows for chloroplast import using its own transpeptide

    • Protein complex formation: Chloroplast-localized AOX2 forms monomers and dimers, similar to AOX regulation in mitochondria, and is present in higher molecular weight complexes in plastid membranes

    • Targeting peptide analysis: All five Arabidopsis AOX members fit the profile of mitochondria-specifically targeted proteins, but AOX2 can also be imported into chloroplasts

  • What are the molecular mechanisms underlying AOX2 regulation during stress responses?

    AOX2 regulation involves complex molecular mechanisms:

    • Transcriptional regulation: ABI3 and ABI4 transcription factors directly bind to the AOX2 promoter and enhance its expression under stress conditions

    • Differential response to inhibitors: Unlike AOX1a, AOX2 expression does not increase in response to antimycin A (a respiratory inhibitor that blocks electron transfer at complex III)

    • Post-translational regulation: Similar to other AOX proteins, AOX2 can form monomers and dimers, suggesting redox regulation of its activity

    • Stress-specific induction: AOX2 transcript is upregulated under various stresses, including salt, osmotic, and oxidative stress conditions

    • Developmental regulation: AOX2 is predominantly expressed during early seed germination and less in vegetative tissues, indicating developmental specificity

  • How can recombinant AOX2 be produced and purified for biochemical studies?

    While the search results focus more on AOX1a than AOX2 for recombinant production, similar methodologies can be applied to AOX2:

    • Cloning strategy: The mature coding sequence of AOX2 can be amplified by PCR and cloned into an expression vector such as pET28a with appropriate tags (e.g., His6-tag)

    • Expression system: E. coli BL21(DE3) can be used as a host for protein expression, with induction by IPTG (0.1 mM)

    • Culture conditions: Growing cultures at 28°C after induction with supplementation of ferrous sulfate (0.1 mM) can enhance expression

    • Purification: Membrane fractionation followed by detergent solubilization (e.g., with DDM) and affinity chromatography using the His-tag

    • Activity assays: Oxygen uptake measurements using specific substrates like duroquinol and inhibitor sensitivity tests can confirm the functionality of purified AOX2

    For AOX2-specific purification, modifications might be necessary due to its unique structural features.

  • How does the alternative pathway involving AOX2 affect cellular energetics during germination?

    The alternative respiratory pathway involving AOX2 has significant implications for cellular energetics:

    • Energy efficiency: The alternative pathway bypasses proton-pumping complexes III and IV, resulting in lower ATP yield compared to the cytochrome pathway

    • Oxygen consumption patterns: During early germination (12-36 hours), the capacity of both cytochrome and alternative pathways increases, with the alternative pathway contributing significantly to total oxygen uptake

    • Metabolic flexibility: The presence of both pathways provides metabolic flexibility during germination, allowing adjustment of energy production based on environmental conditions

    • Redox balance: The alternative pathway helps maintain cellular redox balance during germination when the cytochrome pathway might be limited or inhibited

    • ROS management: By preventing over-reduction of the respiratory chain, AOX2 can reduce ROS production during germination, particularly under stress conditions

  • What methodological approaches are most effective for studying AOX2 function in vivo?

    Several methodological approaches have proven effective:

    • Genetic manipulation: Creating knockout mutants (aox2), overexpression lines (AOX2OE), and complementation lines (aox2Comp) to study AOX2 functions

    • Respiratory measurements: Oxygen uptake measurements with specific inhibitors (KCN for cytochrome pathway, SHAM or n-PG for alternative pathway) to quantify pathway capacities

    • Transcript analysis: Northern blotting or RT-PCR with gene-specific probes to study expression patterns

    • Protein localization: GFP fusion constructs and confocal microscopy to determine subcellular localization

    • Stress assays: Exposing plants to various stresses (salt, ABA, oxidative) and monitoring germination rates and seedling establishment

    • Pharmacological approaches: Using specific inhibitors or ROS scavengers (e.g., ascorbic acid) to determine pathway contributions

    • Yeast one-hybrid and transient expression: To identify transcription factors regulating AOX2 expression

  • How do the structural features of AOX2 contribute to its unique functions?

    AOX2's structural features contribute to its unique functions in several ways:

    • N-terminal targeting sequence: The unique N-terminal extension allows AOX2 to be targeted to both mitochondria and chloroplasts under specific conditions

    • Five-exon structure: Unlike other AOX genes with four exons, AOX2's five-exon structure may contribute to differential regulation or protein folding

    • Conserved catalytic domains: Despite structural differences, AOX2 maintains the conserved iron-binding sites necessary for its oxidase activity

    • Dimer formation capability: Like other AOX proteins, AOX2 can form dimers, suggesting similar regulatory mechanisms involving redox-sensitive cysteines

    • Substrate binding regions: AOX2 can interact with ubiquinol in mitochondria and plastoquinol in chloroplasts, indicating flexible substrate binding properties

  • What are the evolutionary implications of AOX2's unique structure and function?

    Evolutionary analysis provides several insights:

    • Divergence within the AOX family: Phylogenetic analysis shows that AOX2 is more distantly related to the AOX1 subfamily members (AOX1a-d), suggesting early divergence and functional specialization

    • Functional conservation: Despite sequence divergence, AOX2 maintains its basic function as an alternative oxidase, suggesting conservation of critical domains

    • Dual targeting capability: The ability of AOX2 to function in both mitochondria and chloroplasts represents an evolutionary example of protein moonlighting

    • Developmental specialization: AOX2's predominant expression during seed germination suggests evolutionary adaptation for this critical developmental stage

    • Stress response diversity: The differential regulation of AOX isoforms under various stresses indicates evolutionary diversification of their roles in stress adaptation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.