Recombinant Arabidopsis thaliana Aluminum-activated malate transporter 10 (ALMT10)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributor.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development for your request.
Synonyms
ALMT10; At4g00910; A_TM018A10.3; T18A10.21; Aluminum-activated malate transporter 10; AtALMT10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-497
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ALMT10
Target Protein Sequence
MATQEAGKLEWRISVDNGTTERLVPRSGLSKRIFLWLKDLVMKVIMERVAKFMRKAWRIG ADDPAKVVHCLKVGLALSLVSIFYYMRPLYDGVGGNAMWAIMTVVVVFESNVGATFCKCV NRVVATILAGSLGIAVHWVATQSGKAEVFVIGCSVFLFAFAATYSRFVPSFKARFDYGAM IFILTFSLVSVGGYRVDKLVELAQQRVSTIAIGTSICIIITVFFCPIWAGSQLHRLIERN LEKLADSLDGCVAEYFKENEVSTNRNEDENTNMKLQGFKCVLNSKGTEEAMPLIRFSGFS FSQANLARWEPAHGSFNFRHPWKLYVKIGAAMRRCAYCLENLSICINYETEAPDQVKNHF GEACMKLSSASSKILRELADMMKNTRKSSKMDFLVFDMNSAVQELQETLKNVPIETNKPE EVPSEEENKVDSEERTTSMSLHEVLPVATLVSLLIENAARIQTAVEAVDELANLADFEQD SKKKTGDNNTKQPPLSS
Uniprot No.

Target Background

Function
Malate transporter.
Database Links
Protein Families
Aromatic acid exporter (TC 2.A.85) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the ALMT gene family in Arabidopsis thaliana and how is it characterized?

The ALMT (Aluminum-activated Malate Transporter) family in Arabidopsis thaliana consists of 14 members that encode proteins involved in organic acid transport. AtALMT1 (At1g08430) has been identified as a key member responsible for aluminum-activated malate exudation from roots. Characterization of ALMT genes typically involves:

  • Sequence analysis and phylogenetic comparisons with other species

  • Expression profiling in different tissues and under various stress conditions

  • Functional complementation tests in yeast

  • Electrophysiological examination in heterologous expression systems such as Xenopus oocytes

When studying any member of this family, researchers should first perform comparative sequence analysis against the well-characterized AtALMT1 to identify conserved domains and potential functional motifs.

How do ALMT transporters contribute to aluminum tolerance in Arabidopsis?

ALMT transporters, particularly AtALMT1, contribute to aluminum tolerance through the Al-activated efflux of malate from root cells. This mechanism works by:

  • Sensing aluminum presence in the rhizosphere

  • Activating malate transport through the ALMT protein

  • Exudation of malate, which chelates Al³⁺ in the soil solution

  • Formation of Al-malate complexes that are not taken up by roots, protecting them from aluminum toxicity

What experimental approaches are used to measure ALMT transporter activity?

Researchers typically employ multiple complementary approaches to measure ALMT transporter activity:

  • Root malate efflux measurements: Collecting root exudates from plants exposed to Al³⁺ and quantifying organic acids using HPLC

  • Electrophysiological analysis: Expression of the transporter in Xenopus oocytes followed by two-electrode voltage clamp recordings to measure anion currents

  • In vivo fluorescent pH indicators: To detect localized pH changes associated with organic acid transport

  • ¹⁴C-labeled malate: To track malate movement in transgenic plants expressing the transporter

When designing experiments, researchers should include appropriate controls including knockout mutants and plants expressing non-functional ALMT variants to verify specificity of the measured activity.

How do post-translational modifications affect ALMT transporter activity and regulation?

Post-translational modifications of ALMT transporters remain an active area of investigation. Based on research with similar membrane proteins, several approaches can be employed to study modifications:

  • Phosphorylation analysis: Using phospho-specific antibodies or mass spectrometry to identify phosphorylated residues

  • Site-directed mutagenesis: Replacing potential modification sites with non-modifiable amino acids

  • Protein-protein interaction studies: Identifying regulatory partners using co-immunoprecipitation or yeast two-hybrid screening

  • Pharmacological approaches: Using kinase or phosphatase inhibitors to assess the role of phosphorylation events

Research with AtALMT1 suggests that its activity may be regulated through multiple mechanisms, which could involve protein modifications, although specific details about these modifications in ALMT family members require further investigation.

What are the optimal expression systems for recombinant ALMT proteins and how should they be optimized?

Based on recombinant protein expression approaches used for other Arabidopsis membrane proteins, several systems can be considered for ALMT transporters:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliFast growth, high yield, inexpensiveLack of eukaryotic post-translational modificationsUse specialized strains (C41/C43), optimize codon usage, express as fusion proteins
YeastEukaryotic system, post-translational modificationsLower yields than bacteriaUse strong inducible promoters, optimize culture conditions
Insect cellsHigher eukaryotic system, complex folding capabilityMore expensive, technically demandingOptimize baculovirus constructs, use secretion signals
Plant cell culturesNative environment, proper foldingLow yields, slow growthUse viral promoters, optimize extraction protocols

Based on experience with other plant membrane proteins, researchers have achieved 11.5 mg/g to 0.95 mg/g wet weight yields from bacterial expression systems, representing more than 1000-fold improvement over purification from native tissues . For functional studies of ALMT transporters, the Xenopus oocyte expression system has proven particularly valuable for electrophysiological characterization .

How can genetic approaches be used to dissect the relationship between ALMT transporters and quantitative trait loci (QTLs) for aluminum tolerance?

Genetic approaches to understand the relationship between ALMT transporters and aluminum tolerance QTLs should include:

  • Fine mapping: Using recombinant inbred lines (RILs) to narrow down QTL intervals

  • CRISPR/Cas9 genome editing: Creating targeted mutations in candidate genes within QTL regions

  • Complementation testing: Transforming sensitive lines with ALMT genes from tolerant ecotypes

  • Expression QTL (eQTL) analysis: Identifying genetic loci that control ALMT expression levels

Research with AtALMT1 has demonstrated that while it is essential for aluminum tolerance, it does not co-localize with the major aluminum tolerance QTL on chromosome 1, suggesting that other regulatory factors control ALMT function . This emphasizes the need for comprehensive genetic approaches that consider both the transporters themselves and their regulatory networks.

What methodologies can be employed to investigate the interplay between ALMT transporters and other aluminum tolerance mechanisms?

To investigate interactions between ALMT transporters and other aluminum tolerance mechanisms, researchers should consider:

  • Double/triple mutant analysis: Creating plants with mutations in multiple tolerance pathways

  • Transcriptome analysis: Comparing gene expression profiles between wild-type, almt mutants, and other aluminum tolerance mutants under Al stress

  • Metabolome analysis: Measuring changes in organic acid profiles and other metabolites

  • Split-root experiments: Exposing different portions of the root system to varied Al concentrations to assess systemic responses

Studies have shown that while malate exudation correlates strongly with Al tolerance among Arabidopsis ecotypes (r = 0.71), approximately 30% of the variation in tolerance did not correlate with malate release, suggesting additional mechanisms are involved . This indicates that comprehensive approaches addressing multiple pathways simultaneously are needed.

What controls should be included when performing functional studies with recombinant ALMT transporters?

When designing functional studies with recombinant ALMT transporters, researchers should include:

  • Negative controls: Empty vector transformants, inactive mutant versions (e.g., site-directed mutants of critical residues)

  • Positive controls: Well-characterized members of the family (e.g., AtALMT1)

  • Complementation controls: Testing whether the recombinant protein can restore function in knockout mutants

  • Specificity controls: Testing activation by Al³⁺ versus other metal ions

For electrophysiological studies, researchers should measure background currents in non-injected Xenopus oocytes and conduct appropriate ion substitution experiments to confirm the identity of transported anions .

How should researchers address tissue-specific expression and subcellular localization of ALMT transporters?

To accurately determine tissue-specific expression and subcellular localization:

  • GFP fusion proteins: Generate N- and C-terminal fusions to verify localization without disrupting function

  • Tissue-specific promoter analysis: Use promoter-reporter constructs to identify expression patterns

  • Immunolocalization: Develop specific antibodies for native protein detection

  • Cell fractionation: Isolate membrane fractions to confirm protein presence

For validation, researchers should compare results across multiple techniques. When studying members of the ALMT family, it's important to determine whether they localize to the plasma membrane, like AtALMT1, or to other cellular compartments. For subcellular visualization, researchers can employ transient expression in systems like Nicotiana benthamiana leaf epidermal cells, which has proven effective for other Arabidopsis membrane proteins .

How can researchers reconcile differences between in vitro and in vivo activity of ALMT transporters?

Differences between in vitro and in vivo activities of ALMT transporters are common. To address these discrepancies:

  • Consider the lipid environment: Membrane composition affects transporter function and differs between expression systems

  • Evaluate post-translational modifications: These may be absent or different in heterologous systems

  • Assess protein-protein interactions: Native interacting partners may be missing in vitro

  • Examine regulatory contexts: Signaling cascades present in planta may be absent in vitro

Research with AtALMT1 has shown that while the protein retains Al-activated malate transport function when expressed in Xenopus oocytes, the kinetics may differ from those observed in intact plants . Researchers should therefore validate findings across multiple experimental systems.

What approaches help distinguish the specific contributions of individual ALMT family members in plants expressing multiple isoforms?

Distinguishing the contributions of individual ALMT family members requires:

  • Single, double, and higher-order mutants: Generate plants lacking specific combinations of transporters

  • Isoform-specific inhibitors: Develop or identify compounds that selectively block individual transporters

  • Tissue-specific silencing: Use cell-type specific promoters to drive RNAi or artificial microRNAs

  • Promoter swap experiments: Express each isoform under the control of promoters from other family members

Research with AtALMT1 demonstrated that despite the presence of 14 family members, knockout of this single gene eliminated Al-activated malate efflux from roots, indicating non-redundant functions among family members in this specific process .

How might new gene editing technologies advance our understanding of ALMT transporter structure-function relationships?

CRISPR/Cas9 and other gene editing technologies offer powerful approaches for ALMT research:

  • Domain swaps: Create chimeric proteins between different ALMT family members

  • Single amino acid edits: Introduce precise mutations to test structure-function hypotheses

  • Promoter modifications: Alter regulatory elements to understand expression control

  • Tag insertion: Add epitope or fluorescent tags at endogenous loci without disrupting function

These approaches allow researchers to study ALMT function in native genomic contexts, avoiding artifacts associated with overexpression or heterologous systems. Recently developed methods for targeted gene expression in Arabidopsis can be adapted to control ALMT expression in specific cell types .

What are the emerging connections between ALMT transporters and other physiological processes beyond aluminum tolerance?

Beyond aluminum tolerance, ALMT transporters may participate in:

  • Nutrient acquisition: Organic acid release for phosphorus mobilization

  • Guard cell function: Malate channel activity affecting stomatal movements

  • Pathogen responses: Organic acid efflux as part of defense mechanisms

  • Root architecture: Influencing root development through local pH modifications

Researchers investigating these connections should employ comprehensive phenotyping approaches and consider potential crosstalk between stress response pathways. The discoveries that ALMTs can influence multiple physiological processes suggest these transporters may serve as integration points for different environmental signals.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.