Recombinant Arabidopsis thaliana Aluminum-activated malate transporter 2 (ALMT2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliqouting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ALMT2; At1g08440; T27G7.12; Aluminum-activated malate transporter 2; AtALMT2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-501
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ALMT2
Target Protein Sequence
MEKVREIVREGRRVGKEDPRRVVHAFKVGLALALVSSFYYYQPLYDNFGVNAMWAVMTVV VVFEFSVGATLGKGLNRAVATLVAGGLGIGAHHLASLSGPTVEPILLAIFVFVLAALSTF VRFFPRVKARYDYGVLIFILTFALISVSGFREDEILDLAHKRLSTVIMGGVSCVLISIFV CPVWAGQDLHSLLASNFDTLSHFLQEFGDEYFEATEDGDIKEVEKRRRNLERYKSVLNSK SNEEALANFAKWEPRHGQFRFRHPWRQYLAVGALLRQSAYRIDALNSNINSDMQIPMDIK KKIEEPLRRMSSESGKSMKEVSISLKNMTISSSFDIHVVNSQSACKTLSTLLKSGILNDV EPLQMISLMTTVSLLIDIVNLTEKISESVHELASAAKFKNKKKPSKSNSGSIGQAMPNKS HDDDDHVVTILGDVDTSNNVDQSQSHGEISVDSCHHVTIKINDDDSIHDKNEDGDIHVHT NRVSCDHTNASDLLDSGVKKN
Uniprot No.

Target Background

Function
Malate transporter.
Database Links

KEGG: ath:AT1G08440

STRING: 3702.AT1G08440.1

UniGene: At.51529

Protein Families
Aromatic acid exporter (TC 2.A.85) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is ALMT2 and what is its function in Arabidopsis thaliana?

ALMT2 (Aluminum-activated Malate Transporter 2) is a membrane protein encoded by the ALMT2 gene (At1g08440) in Arabidopsis thaliana. The protein is characterized as an aluminum-activated malate transporter that contributes to the plant's response to aluminum toxicity. According to protein database information, ALMT2 (UniProt ID: Q9SJE8) is also known as AtALMT2 .

The full-length protein consists of 501 amino acids with a molecular structure that includes multiple transmembrane domains allowing it to function as an ion channel/transporter. ALMT2 facilitates the transport of malate across cell membranes, which is particularly important in the context of aluminum stress. When activated by aluminum ions, these transporters mediate the efflux of malate from root cells into the soil, where malate can chelate toxic Al³⁺ ions, preventing their entry into plant tissues and mitigating aluminum toxicity.

How can ALMT2 expression patterns be analyzed in different tissues?

Analysis of ALMT2 expression patterns requires multiple complementary approaches:

Northern Blot Analysis:
This technique can reveal tissue-specific expression patterns. Similar to studies of other transporters like AtAMT2, total RNA should be isolated from different organs (roots, stems, rosette leaves, cauline leaves, flowers, and siliques) . Using specific probes complementary to different regions of the ALMT2 transcript allows detection of both full-length and potentially alternatively spliced transcripts. For comprehensive analysis, separate probes complementary to 5' and 3' ends of ALMT2 should be designed to detect potential transcript variants .

Promoter-GUS Fusion Studies:
For higher resolution analysis of spatial expression patterns, researchers should consider generating transgenic Arabidopsis plants expressing the β-Glucuronidase (GUS) reporter gene under the control of the ALMT2 promoter (approximately 1-1.5 kb upstream of the start codon). After histochemical staining, GUS activity can be visualized to determine tissue-specific expression patterns. This approach has successfully revealed expression patterns of other transporters in vascular tissues, root tips, and specific cell types .

Quantitative RT-PCR:
For precise quantification of ALMT2 expression levels across different tissues or under various treatment conditions, qRT-PCR provides the highest sensitivity. When designing this experiment, researchers should:

  • Select appropriate reference genes for normalization

  • Design gene-specific primers spanning exon-exon junctions

  • Include technical and biological replicates

  • Use controls to verify primer specificity and PCR efficiency

What methods are optimal for purifying recombinant ALMT2 protein?

Purification of recombinant ALMT2 requires careful consideration of protein structure and expression system:

Expression Systems:

  • E. coli-based expression: Though commonly used for protein production, membrane proteins like ALMT2 often form inclusion bodies in bacterial systems. If using E. coli, consider fusion tags that enhance solubility (MBP, SUMO) and specialized strains (C41, C43) designed for membrane protein expression.

  • Yeast expression: Systems like Pichia pastoris or Saccharomyces cerevisiae are preferable for functional studies as they provide a eukaryotic environment with proper folding machinery.

  • Insect cell expression: Baculovirus-infected insect cells offer advanced eukaryotic processing capabilities suitable for complex membrane proteins.

Purification Protocol:

  • Cell lysis: Use gentle detergents (DDM, LDAO) to solubilize membrane fractions

  • Affinity chromatography: Utilize His-tagged ALMT2 (as indicated in product specifications) for initial purification

  • Size exclusion chromatography: Further purify protein and assess oligomeric state

  • Verify purity by SDS-PAGE and western blotting

Storage Considerations:
Purified ALMT2 should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage . Repeated freeze-thaw cycles should be avoided; working aliquots should be kept at 4°C for up to one week.

How can functional transport assays be designed to assess ALMT2 activity?

Functional characterization of ALMT2 requires carefully designed transport assays:

Heterologous Expression Systems:

  • Xenopus oocytes: Inject ALMT2 cRNA into oocytes and measure electrophysiological parameters using two-electrode voltage clamp (TEVC) to detect malate transport activity in response to aluminum exposure.

  • Yeast expression systems: Express ALMT2 in yeast mutants defective in endogenous transporters to eliminate background activity. This approach has been successfully used for other Arabidopsis transporters like AtAMT2 .

Transport Measurement Techniques:

  • Radiotracer assays: While direct 14C-malate flux measurements would be ideal, alternative approaches using 13N-labeled compounds with appropriate half-lives may be necessary, similar to methods used for ammonium transporters .

  • pH-sensitive fluorescent probes: Monitor changes in cytosolic or extracellular pH as indirect measures of malate transport.

  • Malate-specific enzyme-coupled assays: Develop assays using malate dehydrogenase to quantify malate concentration changes.

Experimental Design Considerations:

  • Include positive controls (known transporters) and negative controls (empty vector)

  • Test concentration-dependent responses (0.1-10 mM malate)

  • Evaluate aluminum-dependency (0-500 μM Al3+)

  • Assess specificity by testing related organic acids (citrate, oxalate)

  • Examine pH-dependency of transport (pH range 4.0-7.5)

What approaches are effective for investigating ALMT2 regulation in response to aluminum stress?

Understanding ALMT2 regulation requires multi-level analysis:

Transcriptional Regulation:

  • RNA-seq analysis: Compare transcriptomes of plants under control and aluminum stress conditions.

  • Promoter deletion analysis: Generate transgenic plants with progressively truncated ALMT2 promoter regions fused to reporter genes to identify regulatory elements.

  • Chromatin immunoprecipitation (ChIP): Identify transcription factors that bind to the ALMT2 promoter under aluminum stress.

Post-translational Modifications:

  • Phosphoproteomics: Analyze phosphorylation status of ALMT2 under different conditions.

  • Site-directed mutagenesis: Mutate potential phosphorylation sites and assess impact on transport activity.

  • Co-immunoprecipitation: Identify interacting kinases/phosphatases.

Protein Trafficking and Membrane Localization:

  • Fluorescently-tagged ALMT2: Monitor subcellular localization and trafficking under aluminum stress.

  • Membrane fractionation: Quantify ALMT2 abundance in different membrane compartments.

Data Analysis Framework:

Regulatory LevelTechniqueKey ParametersExpected Outcome
TranscriptionalqRT-PCR, RNA-seqTime points (0-48h), Al3+ concentrations (0-500 μM)Fold-change in expression
TranslationalWestern blot, Ribosome profilingTranslation efficiencyProtein abundance changes
Post-translationalMass spectrometryPhosphorylation sitesModified residues
TraffickingConfocal microscopyMembrane localizationRedistribution patterns

How does ALMT2 compare structurally and functionally to other transporters in the ALMT family?

Comparative analysis of ALMT transporters provides evolutionary and functional insights:

Sequence-Based Comparison:
The ALMT family in Arabidopsis includes multiple members with varying functions. Sequence analysis of ALMT2 reveals a predicted structure with transmembrane domains characteristic of this transporter family. Based on the amino acid sequence (MEKVREIVREGRRVGKEDPRRVVHAFKVGLALALVSSFYYYQPLYDNFGVNAMWAVMTVVVVFEFSVGATLGKGLNRAVATLVAGGLGIGAHHLASLSGPTVEPILLAIFVFVLAALSTFVRFFPRVKARYDYGVLIFILTFALISVSGFREDEILDLAHKRLSTVIMGGVSCVLISIFVCPVWAGQDLHSLLASNFDTLSHFLQEFGDEYFEATEDGDIKEVEKRRRNLERYKSVLNSKSNEE...), researchers can identify conserved domains and unique features .

Structural Analysis:

  • Homology modeling: Use known structures of related transporters to predict ALMT2 structure.

  • Cryogenic electron microscopy: For high-resolution structural determination.

  • Molecular dynamics simulations: Predict conformational changes during transport.

Functional Comparison:
Design experiments to compare substrate specificity, transport kinetics, and aluminum sensitivity across ALMT family members.

Evolutionary Analysis:
Construct phylogenetic trees of ALMT transporters across plant species to understand evolutionary relationships and functional divergence.

What CRISPR/Cas9 strategies can be employed to study ALMT2 function in planta?

CRISPR/Cas9 genome editing offers powerful approaches for functional characterization:

Knockout Strategies:

  • Complete gene knockout: Design gRNAs targeting early exons of ALMT2.

  • Domain-specific editing: Target specific functional domains to create partial loss-of-function alleles.

  • Promoter editing: Modify regulatory regions to alter expression patterns.

Base Editing and Prime Editing:
For precise modifications without double-strand breaks, consider:

  • Base editing: Introduction of specific amino acid changes to test structure-function hypotheses.

  • Prime editing: For more complex edits including short insertions or deletions.

Experimental Design Considerations:

  • Guide RNA design: Use computational tools to identify target sites with minimal off-target effects.

  • Screening strategy: Develop high-throughput screening methods to identify edited plants.

  • Phenotypic analysis: Comprehensive evaluation of aluminum sensitivity, root growth, organic acid secretion, and other relevant phenotypes.

Genotype-Phenotype Analysis Framework:

Mutation TypeTarget RegionExpected Molecular ChangePredicted Phenotypic Outcome
KnockoutEarly exonFrameshift/Premature stopComplete loss of function
MissenseTransmembrane domainAltered amino acidModified transport activity
Promotercis-regulatory elementChanged expressionAltered stress response
3'UTRmiRNA binding sitePost-transcriptional regulationExpression timing changes

How can natural variation in ALMT2 be leveraged to understand its adaptive significance?

Natural variation analysis can reveal adaptive significance of ALMT2:

Germplasm Screening:
Similar to studies on other natural variation in Arabidopsis , researchers should:

  • Sequence ALMT2 locus across diverse accessions (>100) from varying aluminum stress environments

  • Identify haplotypes and correlate with environmental aluminum levels

  • Characterize non-synonymous polymorphisms and their impact on protein function

Ecological Correlation Studies:
Analyze ALMT2 sequence diversity in relation to soil aluminum content across the native range of Arabidopsis thaliana accessions. This approach has been successful in understanding adaptive significance of other genes in Arabidopsis .

Genetic Introgression Experiments:
Transfer ALMT2 alleles between accessions to test their fitness consequences in different genetic backgrounds, similar to approaches used for glucosinolate genes .

Field Testing Methodology:

  • Generate near-isogenic lines differing only at ALMT2 locus

  • Conduct multi-year field trials in aluminum-rich and control soils

  • Measure fitness parameters (germination, growth, seed production)

  • Analyze fluctuating selection patterns across environments

Research on natural genetic variation in Arabidopsis defense compounds has demonstrated that no single genotype consistently outperforms others across all environments . Similar principles may apply to ALMT2 variation, where different alleles may be advantageous under specific conditions.

What are the optimal conditions for storing and handling recombinant ALMT2 protein?

Proper handling of recombinant ALMT2 is critical for maintaining activity:

Storage Conditions:

  • Temperature: Store at -20°C for regular use or -80°C for extended storage

  • Buffer composition: Use Tris-based buffer with 50% glycerol optimized specifically for ALMT2

  • Aliquoting: Prepare single-use aliquots to avoid repeated freeze-thaw cycles

  • Working stock: Keep working aliquots at 4°C for up to one week

Handling Procedures:

  • Thawing: Thaw protein samples on ice to prevent denaturation

  • Temperature sensitivity: Avoid exposure to temperatures above 4°C during experiments

  • Buffer compatibility: Test compatibility with experimental buffers before use

  • Detergent considerations: For membrane proteins like ALMT2, maintain appropriate detergent concentrations above critical micelle concentration

Quality Control Protocols:

  • Activity assays: Regularly test transport activity using standardized assays

  • Protein integrity: Verify by SDS-PAGE before experimental use

  • Mass spectrometry: Periodic confirmation of protein identity and modifications

How can genetic transformation systems be optimized for ALMT2 studies in Arabidopsis?

Effective genetic transformation is essential for functional studies:

Vector Design Considerations:

  • Promoter selection: Use native ALMT2 promoter for physiological expression or 35S for overexpression

  • Tag selection: Consider impact of N- versus C-terminal tags on protein function

  • Selection markers: Choose appropriate markers compatible with experimental design

Transformation Methods:

  • Floral dip transformation: Standard approach for Arabidopsis using Agrobacterium tumefaciens

  • Protoplast transformation: For transient expression studies

  • CRISPR delivery: Ribonucleoprotein complex delivery for DNA-free editing

Screening Protocols:

  • Antibiotic/herbicide selection: Primary screening of transformed plants

  • PCR genotyping: Confirmation of transgene presence

  • Expression verification: RT-PCR or western blotting to confirm expression

  • Functional validation: Phenotypic assays to verify transgene functionality

Optimization Strategies:
Improve transformation efficiency through:

  • Plant growth conditions optimization

  • Agrobacterium strain selection

  • Surfactant addition during floral dip

  • Multiple transformation rounds

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.