Recombinant Arabidopsis thaliana Aluminum-activated malate transporter 7 (ALMT7)

Shipped with Ice Packs
In Stock

Description

Channel Architecture

  • Transmembrane Organization: ALMT7 contains 6–8 predicted transmembrane helices, with the first three helices essential for pore formation .

  • Multimerization: Evidence from rice OsALMT7 and wheat TaALMT1 suggests ALMTs function as homomers or heteromers. Bimolecular fluorescence complementation (BiFC) assays confirm self-interaction and dominant-negative effects by truncated mutants .

  • Cryo-EM Insights: Structural studies on homologous ALMTs (e.g., GmALMT12) reveal a dimeric architecture with cytosolic helical domains (CHDs) critical for malate sensitivity .

Electrophysiological Activity

  • Malate Transport: ALMT7 mediates voltage-dependent malate efflux, a trait shared with OsALMT7 and TaALMT1. Truncated variants lacking transmembrane helices retain partial activity, suggesting structural redundancy .

  • pH and Ligand Sensitivity: Activity is modulated by extracellular malate and cytosolic pH, akin to ALMT12/QUAC1 channels in stomatal regulation .

Key Discoveries

  1. Truncation Tolerance: OsALMT7 mutants lacking two transmembrane helices (paab1-t1/t2) retain malate transport capability, challenging earlier assumptions about pore formation .

  2. Dominant-Negative Effects: Co-expression of wild-type ALMT7 with truncated mutants suppresses channel activity, indicating functional interdependence .

  3. Subcellular Localization: ALMT homologs localize to plasma membranes (e.g., AtALMT1) or vacuoles (e.g., AtALMT9), suggesting tissue-specific roles in ion homeostasis .

Agricultural and Biotechnological Relevance

  • Aluminum Tolerance: ALMT-mediated malate exudation chelates rhizotoxic Al³⁺, a mechanism explored in crops like wheat and rice .

  • Stomatal Regulation: Guard-cell ALMTs (e.g., AtALMT12) modulate stomatal closure via malate efflux, impacting drought resilience .

  • Protein Engineering: Recombinant ALMT7 enables structure-function studies to optimize anion transport for crop improvement .

Comparative Analysis of ALMT Family Members

FeatureALMT7TaALMT1AtALMT12/QUAC1
LocalizationPlasma membrane (predicted)Plasma membraneGuard cell plasma membrane
FunctionMalate efflux, stress responseAluminum toleranceStomatal closure
MultimerizationHomomer/heteromerHomomerDimer
Key DomainsTransmembrane helices 1–3C-terminal regulatory domainCytosolic CHD
Mutant PhenotypeReduced malate flux (paab1) Al sensitivity loss Impaired stomatal closure

Technical Considerations for Recombinant ALMT7

  • Reconstitution: Lyophilized ALMT7 requires careful solubilization in Tris/PBS buffers with glycerol to prevent aggregation .

  • Activity Assays: Electrophysiological recordings (e.g., TEVC in Xenopus oocytes) and malate flux measurements are standard for functional validation .

Future Directions

  1. Structural Resolution: Cryo-EM or crystallography of ALMT7 could clarify its gating mechanism and malate-binding sites.

  2. Crop Engineering: Deploying ALMT7 variants in crops may enhance aluminum tolerance or water-use efficiency via stomatal optimization.

  3. Interaction Networks: Identifying ALMT7-binding partners (e.g., kinases/phosphatases) will elucidate regulatory pathways .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your needs when placing the order. We will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method or location. For precise delivery information, please consult your local distributors.
Note: All our proteins are shipped standard with blue ice packs. If dry ice shipment is requested, please notify us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference for your usage.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
ALMT7; At2g27240; F12K2.18; Aluminum-activated malate transporter 7; AtALMT7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-506
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ALMT7
Target Protein Sequence
MEKVREIVREGRRVAKEDPRRVVHSFKVGLVLALVSSFYYYQPLYDSFGVNAMWAVMTVV VVFEFSVGATLGKGLNRVAATLFAGGLGIGAHHLASMSGPTGEPILLAVFVFVQAALSTF VRFFPRVKARYDYSLLIFILTFALISVSGFREEQVVKLTHKRISTVIIGGLSCVIISIFV CPVWAGQDLHSLIASNFEKLSFFLLGNSFHYVSSDLNSITLLRKIKSWRLADFGDKYCEV VENDGAKEVDKRKKDFDNYKSVLNSKSNEESLANFAKWEPGHGQFRFRHPWKQYLAVGEL IRQCAYRIHALNSYLNADNQVSVDIKKKLGEPLRRMSLESGKAMKEMSISLKKMTKPSSS DLHVQNAKSACKSLTNLLNSGILKEVEPLELVSLLTAISLLIDIINLTEKILESLHELAT AAKFKNKIEHPLFSEKPKAKSFVSVRSIKCHDDHVVIIIEDDGNNDDTSKNDNGSKEVSI HEKHEDDDTHVDARCVSCGHTSVCVK
Uniprot No.

Target Background

Function
Malate transporter.
Database Links

KEGG: ath:AT2G27240

STRING: 3702.AT2G27240.1

UniGene: At.38795

Protein Families
Aromatic acid exporter (TC 2.A.85) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Arabidopsis thaliana ALMT7?

ALMT7 belongs to the aluminum-activated malate transporter family, which functions as anion channels in plants. Similar to other ALMT proteins, ALMT7 contains multiple transmembrane helices that form functional channels in cellular membranes. The protein consists of a transmembrane domain with typically 6-7 transmembrane helices and a C-terminal region that extends into the cytoplasm .

The functional activity of ALMT channels depends on the integrity of these transmembrane regions. Research using truncated versions of related ALMTs (such as OsALMT7 from rice) demonstrates that proteins lacking at least two transmembrane helices exhibit significantly reduced malate transport capacity, suggesting these regions are critical for proper channel formation and function .

How do ALMT7 proteins assemble to form functional channels?

ALMT7 proteins assemble as homomers to form functional channels in the plasma membrane. Based on studies with rice OsALMT7, these channels operate as multimeric complexes where several ALMT subunits combine to create the functional anion channel .

This has been demonstrated through co-expression studies in Xenopus laevis oocytes, where physical interactions between multiple ALMT7 proteins were detected. When wild-type and truncated mutant forms were co-expressed, the truncated versions interfered with normal channel function, providing further evidence for homomeric assembly. This oligomeric structure appears to be conserved across ALMT family members, as similar inhibitory effects have been observed with TaALMT1 mutants .

What expression systems are most effective for studying recombinant ALMT7?

For functional characterization of Arabidopsis ALMT7, heterologous expression in Xenopus laevis oocytes has proven most effective. This system allows for:

  • Controlled expression of wild-type and mutant ALMT7 variants

  • Electrophysiological measurements of channel activity

  • Co-expression of multiple protein variants to study interactions

  • Assessment of substrate specificity and kinetics

The procedure involves:

  • Cloning the ALMT7 cDNA into an appropriate expression vector

  • In vitro transcription to generate cRNA

  • Microinjection of cRNA into oocytes

  • Incubation period (typically 2-3 days)

  • Two-electrode voltage clamp recordings to measure anion currents

Alternative expression systems include mammalian cell lines or plant protoplasts, though these typically yield lower expression levels and present additional technical challenges for electrophysiological measurements .

How should researchers design experiments to investigate ALMT7 structure-function relationships?

A systematic approach to ALMT7 structure-function studies includes:

  • Truncation analysis: Create C-terminal and/or N-terminal truncations to identify regions critical for channel activity. For example, studies with rice OsALMT7 revealed that truncation mutants lacking two transmembrane helices exhibited significantly reduced malate transport .

  • Site-directed mutagenesis: Target conserved residues, particularly charged amino acids within transmembrane domains that may form the ion conduction pathway.

  • Domain swapping: Exchange domains between ALMT family members with different properties to identify regions responsible for substrate specificity or activation mechanisms.

  • Fluorescence-based localization: Fuse ALMT7 with fluorescent proteins to confirm plasma membrane localization and proper trafficking.

  • Co-immunoprecipitation: Detect protein-protein interactions to confirm homomeric assembly.

To minimize experimental bias, implement:

  • Blind analysis of electrophysiological data

  • Multiple biological and technical replicates

  • Appropriate controls (non-injected oocytes, inactive mutants)

  • Quantitative measurements rather than qualitative assessments3

How can researchers investigate the physiological roles of ALMT7 in planta?

To determine ALMT7's physiological functions in Arabidopsis, implement a multi-faceted approach:

  • Gene knockout/knockdown strategies:

    • CRISPR/Cas9 genome editing to generate null mutants

    • RNAi or artificial microRNA approaches for tissue-specific silencing

    • T-DNA insertion lines (verify complete loss of function)

  • Phenotypic analysis under varied conditions:

    • Aluminum stress tolerance assays

    • Growth measurements under different pH conditions

    • Analysis of malate secretion in response to environmental stimuli

    • Assessment of reproductive development and yield components

  • Complementation studies:

    • Express wild-type ALMT7 in knockout backgrounds

    • Introduce mutant variants to determine critical residues/domains

    • Use tissue-specific or inducible promoters to dissect spatial/temporal functions

  • Natural variation analysis:

    • Compare ALMT7 sequence and expression across Arabidopsis ecotypes

    • Correlate functional differences with adaptive traits in different environments

When designing these experiments, consider using a factorial design to assess how ALMT7 function might interact with multiple environmental variables simultaneously, as observed in studies of other defense-related genes in Arabidopsis 3.

What analytical approaches are recommended for interpreting electrophysiological data from ALMT7 studies?

When analyzing electrophysiological data from ALMT7 studies:

  • Current-voltage relationships:

    • Plot I-V curves under different substrate concentrations

    • Determine reversal potentials to characterize ion selectivity

    • Calculate conductance from the slope of I-V curves

  • Kinetic analysis:

    • Measure concentration-dependent activation

    • Determine apparent Km and Vmax values

    • Analyze time-dependent changes in current amplitude

  • Statistical considerations:

    • Apply appropriate statistical tests (ANOVA, t-test)

    • Calculate uncertainty propagation for derived parameters

    • Report measurements with standard errors or confidence intervals

  • Minimizing bias:

    • Perform blind analysis when comparing different constructs

    • Include technical and biological replicates

    • Use randomized testing order

Example data table format for malate transport analysis:

ConstructCurrent at -140mV (μA)Reversal Potential (mV)Relative Activity (%)
Wild-type ALMT7-2.45 ± 0.18-24.3 ± 1.2100
Truncated ALMT7-0.31 ± 0.05-18.2 ± 1.512.7
Point mutant #1-1.12 ± 0.14-22.8 ± 1.345.7
Non-injected control-0.08 ± 0.02N/A0

When analyzing data, account for both systematic errors (calibration issues) and random errors, ensuring proper uncertainty propagation in calculated parameters3 .

How does Arabidopsis ALMT7 compare functionally with ALMT homologs from other species?

ALMT proteins show conserved functions across species but with important variations in activation mechanisms and physiological roles:

  • Substrate specificity:

    • TaALMT1 (wheat): Primarily transports malate, activated by aluminum

    • AtALMT1 (Arabidopsis): Malate transporter involved in aluminum resistance

    • AtALMT9 (Arabidopsis): Vacuolar malate channel

    • AtALMT12 (Arabidopsis): Guard cell anion channel (malate and chloride)

    • OsALMT7 (rice): Malate transporter affecting panicle development

  • Localization patterns:

    • Plasma membrane: TaALMT1, AtALMT1, OsALMT7

    • Vacuolar membrane: AtALMT9

    • Specialized tissues: OsALMT7 in vascular tissues

  • Activation mechanisms:

    • Aluminum-activated: TaALMT1, AtALMT1

    • Constitutively active: AtALMT9

    • Voltage-dependent: AtALMT12

To study these comparative aspects, design experiments that:

  • Express multiple ALMT homologs in the same experimental system

  • Test responses to various activators and substrates

  • Measure kinetic parameters under identical conditions

  • Use chimeric proteins to identify domains responsible for specific properties

How can researchers address conflicting findings about ALMT7 function across different studies?

When faced with contradictory results across ALMT7 studies:

  • Methodological differences assessment:

    • Compare expression systems (oocytes vs. mammalian cells vs. plant protoplasts)

    • Examine recording solutions (ionic composition, pH, temperature)

    • Assess protein constructs (tags, truncations, mutations)

    • Review data analysis methods (normalization, statistical approaches)

  • Experimental validation:

    • Replicate key experiments using multiple approaches

    • Collaborate with labs reporting different results

    • Utilize standardized protocols and reagents

  • Reconciliation strategies:

    • Consider physiological context (tissue specificity, developmental stage)

    • Test for post-translational modifications affecting activity

    • Examine protein-protein interactions that might modify function

    • Investigate environmental factors that influence activity

  • Reporting recommendations:

    • Provide comprehensive methodological details

    • Include all negative results

    • Share raw data in public repositories

    • Explicitly discuss limitations and potential confounding factors 3

What is known about the mechanism of ALMT7 homomeric assembly and its impact on channel function?

Based on research with related ALMT proteins:

  • Oligomeric structure:

    • ALMT channels function as multimeric complexes

    • Physical interactions between multiple ALMT subunits create functional channels

    • Co-expression studies confirm interactions between wild-type and mutant subunits

  • Assembly domains:

    • Transmembrane domains play critical roles in subunit assembly

    • C-terminal cytoplasmic regions may contribute to oligomerization

    • Conserved residues likely form interaction interfaces

  • Functional impacts:

    • Truncated or mutant subunits can exhibit dominant negative effects

    • When co-expressed with wild-type proteins, mutant subunits can suppress channel activity

    • This supports a model where multiple subunits contribute to a single ion conduction pathway

This oligomeric assembly has been demonstrated through co-expression of wild-type and mutant forms in Xenopus oocytes, where physical interactions between different protein variants were detected. The finding that truncated variants of OsALMT7 interfere with wild-type function provides strong evidence for homomeric assembly being crucial for proper channel function .

How does natural variation in ALMT7 contribute to adaptive traits in Arabidopsis populations?

Natural variation in ALMT-related genes can contribute significantly to plant adaptation to different environments:

  • Geographic distribution and allelic variation:

    • Different Arabidopsis ecotypes may contain ALMT7 variants adapted to local soil conditions

    • Sequence polymorphisms can affect transport activity, substrate specificity, or regulation

    • Population genetics approaches can identify signatures of selection

  • Environmental adaptation:

    • Soil acidity and aluminum levels vary across habitats

    • ALMT7 variants may provide differential fitness advantages depending on soil chemistry

    • Studies show that defense-related genes (like those involved in glucosinolate production) demonstrate environment-dependent fitness effects

  • Experimental approaches:

    • Sequence ALMT7 across diverse Arabidopsis accessions

    • Correlate sequence variation with functional differences

    • Perform reciprocal transplant experiments with ALMT7 variants

    • Use genome-wide association studies (GWAS) to link natural variants to phenotypic traits

Studies of natural variation in other Arabidopsis defense genes have shown that no single gene variant provides the best fitness across all environments, suggesting complex environment-dependent selection pressures that likely also apply to ALMT7 .

What methodologies are recommended for investigating ALMT7 roles in complex environmental adaptation?

To study ALMT7's role in environmental adaptation:

  • Field trials with genetic variants:

    • Grow plants with different ALMT7 alleles across multiple environments

    • Measure fitness components (survival, growth, reproduction)

    • Use a multi-year approach to capture temporal variation

    • Compare homozygous lines differing only at the ALMT7 locus

  • Environmental simulation:

    • Create controlled environments simulating different soil conditions

    • Vary aluminum concentrations, pH, and nutrient availability

    • Measure physiological responses and fitness parameters

    • Combine with -omics approaches to identify global responses

  • Statistical and modeling approaches:

    • Use factorial experimental designs to test interaction effects

    • Apply mixed models to account for environmental variation

    • Calculate fitness differentials across environments

    • Model gene-by-environment interactions

  • Integration with ecological data:

    • Correlate ALMT7 variants with soil chemistry in natural habitats

    • Consider microbial communities that may influence root exudation

    • Measure competitive interactions in mixed populations

Research on other defense-related genes in Arabidopsis has demonstrated that fitness benefits are highly dependent on the specific environment, with temporal and spatial variation affecting selection pressures. Similar complex patterns likely exist for ALMT7 function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.