Recombinant Arabidopsis thaliana Aluminum-activated malate transporter 8 (ALMT8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. You may use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize the development of your specified tag.
Synonyms
ALMT8; At3g11680; T19F11.8; Aluminum-activated malate transporter 8; AtALMT8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-488
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ALMT8
Target Protein Sequence
MDLNAQEKKAGFFQRLQDFPSKLKDDVTKRVKNVQKFAKDDPRRIIHSMKVGVALTLVSL LYYVRPLYISFGVTGMWAILTVVVVFEFTVGGTLSKGLNRGFATLIAGALGVGAVHLARF FGHQGEPIVLGILVFSLGAAATFSRFFPRIKQRYDYGALIFILTFSFVAISGYRTDEILI MAYQRLSTILIGGTICILVSIFICPVWAGEDLHKMIANNINKLAKYLEGFEGEYFQPEKI SKETSSCVREYKSILTSKSTEDSLANLARWEPGHGRFRLRHPWKKYLKIAGLVRQCAVHL EILNGYVLSNDKAPQEFESKIQEPITTMSREVGEALKAIAKSIKTMRNDSACVNAHIDNS KKAIKNLKIALKSSYPETYKDLLEIIPGVTMASILIEVVNCVEKIYEAVEEFSGLAHFKE TLDSKLSAEIGQHQLLHRGCVKPVLDGDNEKEDNSSCHVLITVHDEGYLPTATAKNVLGA EKTRVDIV
Uniprot No.

Target Background

Function
Malate transporter.
Database Links

KEGG: ath:AT3G11680

STRING: 3702.AT3G11680.1

UniGene: At.50172

Protein Families
Aromatic acid exporter (TC 2.A.85) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the significance of ALMT8 in Arabidopsis thaliana?

ALMT8 belongs to the aluminum-activated malate transporter family that plays crucial roles in plant responses to environmental stresses, particularly aluminum toxicity in acidic soils. In Arabidopsis, ALMT8 functions as a membrane transporter that facilitates malate efflux when activated by aluminum ions. This mechanism is part of the plant's defense against aluminum toxicity, as malate can chelate aluminum in the rhizosphere, preventing its uptake and subsequent cellular damage. Arabidopsis thaliana serves as an ideal model for studying ALMT8 due to its compact genome (approximately 120 megabases organized into five chromosomes) and estimated 20,000 genes that have been fully sequenced . The completion of the Arabidopsis genome sequencing in 2000 has significantly enhanced our understanding of plant biology and provides a solid foundation for ALMT8 research.

How does recombinant protein expression enhance ALMT8 research?

Recombinant protein production enables the study of ALMT8 structure and function in controlled experimental systems. By expressing ALMT8 cDNA in heterologous or homologous hosts, researchers can overcome the typically low abundance of this transporter in native tissues. This approach facilitates biochemical characterization and functional analysis that would be challenging with naturally expressed levels. The Arabidopsis-based super-expression system provides a particularly valuable platform for homologous recombinant protein production, especially for multi-subunit membrane protein complexes like transporters . Using Arabidopsis for ALMT8 expression maintains the protein in its native cellular environment, preserving critical post-translational modifications and protein-protein interactions that may be essential for proper function and regulation.

What genomic resources are available for ALMT8 research in Arabidopsis?

Arabidopsis offers extensive genomic resources that significantly benefit ALMT8 research. The complete genome sequence deposited in GenBank by international consortia provides a comprehensive foundation for gene identification and characterization . Researchers can access detailed genomic annotations, promoter sequences, and regulatory elements associated with ALMT8. Additionally, numerous T-DNA insertion lines and other mutant collections are available through stock centers, enabling reverse genetic approaches to study ALMT8 function. The wealth of transcriptomic data across various tissues, developmental stages, and stress conditions further supports investigations into ALMT8 expression patterns and regulatory networks.

What experimental designs are most appropriate for studying ALMT8 function?

When investigating ALMT8 function, researchers should consider block design experiments that control for variables potentially influencing ALMT8 expression and activity. For example, when testing ALMT8-mediated aluminum tolerance, plants should be randomly assigned to treatment groups while ensuring balanced distribution of potentially confounding factors such as plant age or size . A matched pairs experimental design offers particular advantages, where each plant serves as its own control by measuring parameters before and after aluminum treatment. This approach reduces variability caused by individual differences between plants and increases statistical power . For genetic studies, quantitative trait locus (QTL) analysis using recombinant inbred lines (RILs) can identify genomic regions associated with variation in ALMT8 function across different Arabidopsis accessions .

How can QTL analysis enhance understanding of natural variation in ALMT8 function?

QTL analysis provides a powerful approach for investigating natural variation in ALMT8 function and regulation. By creating mapping populations such as recombinant inbred lines (RILs) from divergent Arabidopsis accessions, researchers can identify genetic loci that contribute to differences in aluminum tolerance or ALMT8 expression. The QTL mapping approach has been successfully used to study various stress responses in Arabidopsis, including germination under salt stress and seed longevity . For ALMT8 research, QTL analysis could reveal regulatory elements or interacting proteins that modulate transporter activity across different ecotypes. An immortal mapping population allows repeated testing under different aluminum concentrations or soil pH conditions, enabling robust identification of consistent QTLs . The approach also facilitates the detection of epistatic interactions between multiple loci affecting ALMT8 function.

What control strategies should be implemented when working with recombinant ALMT8?

Effective controls are essential when working with recombinant ALMT8 to ensure observed effects are specifically attributable to the transporter. A comprehensive control strategy should include:

  • Expression of non-functional ALMT8 mutants (with key residues altered) using the same expression system

  • Empty vector controls subjected to identical treatment conditions

  • Wild-type plants alongside transgenic lines to assess baseline responses

  • Expression of related ALMT family members to evaluate transporter specificity

Additionally, blind experimental designs where researchers are unaware of sample identities during measurement and analysis can minimize bias . When testing aluminum responses, the experimental design should include appropriate metal chelators as controls to verify that observed effects are due to aluminum-activated ALMT8 rather than constitutive transporter activity or responses to other metal ions potentially present as contaminants.

What expression systems are optimal for recombinant ALMT8 production in Arabidopsis?

For recombinant ALMT8 production in Arabidopsis, several expression systems offer distinct advantages. The recently established Arabidopsis-based super-expression system provides an excellent platform for homologous expression of ALMT8 . This system maintains native post-translational modifications and cellular trafficking, which are critical for membrane proteins like ALMT8. The choice of promoter significantly impacts expression levels, with the cauliflower mosaic virus 35S promoter commonly used for constitutive expression and inducible promoters offering temporal control of expression.

The optimal expression strategy should consider:

Expression SystemAdvantagesLimitationsBest Applications
Constitutive (35S)High expression levels, simple protocolPotential toxicity if ALMT8 overexpression disrupts ion homeostasisProtein production for biochemical studies
Inducible (e.g., estradiol)Temporal control, reduced toxicityMore complex experimental setupFunctional studies requiring precise timing
Tissue-specificTargeted expression in relevant tissuesLower total protein yieldPhysiological studies of ALMT8 in specific cell types
Native promoterPhysiologically relevant expression patternLower expression levelsStudies of natural regulation and function

For preparative-scale production, the super-expression system with appropriate subcellular targeting signals can yield sufficient quantities of functional ALMT8 for structural and biochemical characterization .

What purification strategies work best for membrane-bound proteins like ALMT8?

Purifying membrane proteins like ALMT8 presents significant challenges that require specialized approaches. An effective purification strategy typically involves:

  • Membrane isolation: Differential centrifugation followed by sucrose gradient fractionation to isolate plasma membrane fractions where ALMT8 is localized.

  • Solubilization: Careful selection of detergents is critical for extracting ALMT8 from membranes while maintaining structure and function. Mild non-ionic detergents (e.g., n-dodecyl-β-D-maltoside) or amphipols often preserve membrane protein integrity better than harsh ionic detergents.

  • Affinity purification: Incorporating affinity tags (His, FLAG, or Strep) at termini less likely to interfere with function enables selective purification. For ALMT8, C-terminal tags are often preferable as the N-terminus may contain important targeting information.

  • Size exclusion chromatography: As a final polishing step to separate monomeric ALMT8 from aggregates or other contaminants.

The choice of purification method should consider the downstream applications, as structural studies require higher purity but may tolerate lower activity, while functional assays may require less purity but demand higher retention of native activity.

What methods effectively measure ALMT8 transport activity?

Measuring ALMT8 transport activity requires approaches that can detect malate efflux in response to aluminum. Several complementary techniques provide robust functional characterization:

  • Radioisotope flux assays: Using 14C-labeled malate to directly measure transport across membranes. This approach offers high sensitivity but requires specialized facilities for handling radioisotopes.

  • Electrophysiological techniques: Patch-clamp recordings can directly measure ALMT8-mediated currents in response to aluminum application, providing detailed kinetic information about transporter function.

  • Fluorescence-based assays: pH-sensitive or ion-sensitive fluorescent dyes can indirectly monitor ALMT8 activity by detecting changes in ion concentrations or pH associated with malate transport.

  • Biochemical malate quantification: Enzymatic assays using malate dehydrogenase can quantify malate levels in growth media to assess efflux from plant tissues or expression systems.

When designing activity assays, researchers should consider the following parameters:

ParameterTypical RangeConsiderations
Al3+ concentration10-500 μMConcentration-dependent activation, potential toxicity at higher levels
pH4.5-6.0Critical for Al3+ speciation and ALMT8 function
Malate concentration1-10 mMSubstrate availability for transport
Time courseMinutes to hoursCapture both immediate responses and longer-term effects
Temperature20-25°CAffects transport kinetics and protein stability

How can protein-protein interactions of ALMT8 be effectively studied?

Understanding ALMT8 protein-protein interactions provides critical insights into its regulation and integration into cellular signaling networks. Several complementary approaches can effectively characterize these interactions:

  • Co-immunoprecipitation (Co-IP): Using antibodies against ALMT8 or its interaction partners to pull down protein complexes from plant tissues or expression systems. This approach works particularly well when combined with epitope-tagged versions of ALMT8 expressed in Arabidopsis .

  • Split-reporter assays: Techniques like bimolecular fluorescence complementation (BiFC) or split-luciferase assays can visualize interactions in living plant cells, providing spatial information about where within the cell ALMT8 interactions occur.

  • Yeast two-hybrid screening: Modified membrane yeast two-hybrid systems can identify novel interaction partners from Arabidopsis cDNA libraries, though care must be taken to account for the membrane localization of ALMT8.

  • Proximity-dependent labeling: Approaches like BioID or APEX2, where ALMT8 is fused to a promiscuous biotin ligase, can identify proteins in close proximity to ALMT8 in its native membrane environment.

Each technique has distinct advantages and limitations, and combining multiple approaches provides the most comprehensive understanding of ALMT8 interaction networks.

How should researchers analyze ALMT8 expression data across different experimental conditions?

Analyzing ALMT8 expression data requires careful consideration of experimental design and appropriate statistical methods. When examining expression changes across treatments or genotypes, researchers should:

  • Normalize expression data: Use stable reference genes validated specifically for aluminum stress conditions rather than assuming traditional housekeeping genes remain stable.

  • Apply appropriate statistical tests: For comparing expression across multiple conditions, ANOVA followed by post-hoc tests (like Tukey's HSD) is typically appropriate. For time-course experiments, repeated measures analyses may be required .

  • Consider biological replicates: Ensure sufficient biological replication (minimum n=3, preferably n≥5) to account for natural variation in ALMT8 expression.

  • Correlate with functional data: Integrate expression data with measurements of malate exudation or aluminum tolerance to establish functional relationships.

  • Visualize data effectively: Use clear, informative plots that highlight treatment effects while honestly representing variability.

When analyzing quantitative trait loci (QTL) data related to ALMT8 function or expression, researchers should use appropriate mapping software and statistical tools to identify genomic regions significantly associated with phenotypic variation . Multiple testing corrections should be applied to minimize false positives, and QTL intervals should be evaluated for the presence of ALMT8 or related genes and regulatory elements.

What statistical approaches are most appropriate for interpreting ALMT8 activation data?

Interpreting ALMT8 activation data requires statistical approaches that can account for the complex relationships between aluminum concentration, malate transport, and physiological responses. Key statistical considerations include:

  • Dose-response modeling: Fit appropriate models (e.g., Hill equation) to characterize the relationship between aluminum concentration and ALMT8 activity, extracting parameters like EC50 and maximum response.

  • Time-series analysis: When examining the temporal dynamics of ALMT8 activation, time-series statistical methods can identify significant patterns and response phases.

  • Multivariate analysis: Techniques like principal component analysis (PCA) or partial least squares discriminant analysis (PLS-DA) can help identify patterns in complex datasets with multiple variables related to ALMT8 function.

  • Mixed-effects models: When analyzing data from experiments with both fixed factors (e.g., aluminum concentration) and random factors (e.g., plant line), mixed-effects models provide appropriate statistical framework .

  • Non-parametric alternatives: If data violate assumptions of parametric tests (as is common with biological data), non-parametric alternatives like Mann-Whitney U test or Kruskal-Wallis should be considered.

For matched-pairs experimental designs, paired statistical tests increase power by controlling for individual variation between plants or samples . This approach is particularly valuable when measuring ALMT8 activity before and after aluminum treatment in the same system.

How can genetic engineering approaches enhance ALMT8 functionality for research purposes?

Genetic engineering offers powerful tools to enhance ALMT8 functionality for research applications. Strategic modifications can create versions of ALMT8 with altered properties that provide deeper insights into transporter mechanisms and regulation:

  • Site-directed mutagenesis: Targeted modification of specific amino acid residues can identify domains critical for aluminum sensing, malate binding, or transport. Creating a library of ALMT8 variants with systematic mutations provides a structure-function map of the transporter.

  • Domain swapping: Exchanging domains between ALMT8 and related transporters can define regions responsible for substrate specificity, aluminum activation, or regulatory interactions.

  • Fluorescent protein fusions: Creating ALMT8-fluorescent protein fusions enables visualization of subcellular localization and trafficking in living cells. Careful design is necessary to ensure the fusion doesn't disrupt transporter function.

  • Inducible expression systems: Engineering ALMT8 under the control of chemically inducible promoters allows precise temporal control of expression, facilitating studies of immediate responses to ALMT8 activity.

  • CRISPR-based approaches: Using CRISPR/Cas9 to edit the endogenous ALMT8 gene provides a means to study modified versions of the transporter in its native genomic context and regulatory environment.

When designing genetic engineering strategies, researchers should consider potential impacts on protein folding, membrane insertion, and post-translational modifications that may be critical for ALMT8 function .

How can systems biology approaches integrate ALMT8 into broader aluminum response networks?

Systems biology approaches provide a framework for understanding how ALMT8 functions within the broader context of aluminum response networks in Arabidopsis. These integrative strategies help elucidate the complex interplay between different components of stress response systems:

These integrative approaches rely on sophisticated statistical methods and bioinformatic tools to identify meaningful patterns and relationships within complex, multidimensional datasets .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.