Recombinant Arabidopsis thaliana Ankyrin repeat-containing protein At3g12360 (At3g12360)

Shipped with Ice Packs
In Stock

Description

Expression Systems

Recombinant ITN1 is produced in heterologous systems, including:

  • E. coli: Most common platform for cost-effective, high-yield production .

  • Yeast/Mammalian/Insect Cells: Used for complex post-translational modifications .

Functional Role in Salt Tolerance

ITN1 regulates salt tolerance via:

  1. ROS Modulation: Loss-of-function mutants exhibit reduced ROS gene induction, leading to enhanced salt tolerance .

  2. Ion Homeostasis: Likely interacts with membrane transporters to maintain ion balance under stress.

Key Research Findings

Study SystemObservationCitation
A. thaliana mutantsitn1 mutants show 30–40% improved seedling growth under 150 mM NaClThaleMine
Protein interactionBinds RCN1 to influence vesicle trafficking and membrane localizationThaleMINE

Applications in Research

  • Structural Studies: Full-length recombinant ITN1 enables crystallization and cryo-EM analyses of membrane-associated complexes .

  • Stress Response Pathways: Used to dissect signaling cascades in abiotic stress .

  • Antibody Production: Rabbit polyclonal antibodies against ITN1 (validated for ELISA/Western blot) aid in protein localization studies .

Limitations and Considerations

  • Bioactivity Variability: Solubility is guaranteed, but functional activity may require refolding for E. coli-expressed inclusion bodies .

  • Species-Specific Modifications: For native-like glycosylation, mammalian/insect cell systems are preferable .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary based on the purchase method and location. For specific delivery estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ITN1; At3g12360; MQC3.17; T2E22.31; Ankyrin repeat-containing protein ITN1; Protein INCREASED TOLERANCE TO NACL
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-590
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ITN1
Target Protein Sequence
MAASSYVDGERDMEKGGMILLQSSENQNPMIDPSPTPSPSATATAPALVLSNSGKRMDQA GKKKYVKQVTGRHNDTELHLAAQRGDLAAVQQILKDINSQMEGILSGEEFDAEVAEIRAS IVNEVNELGETALFTAADKGHLDVVKELLKYSSRESIAKKNRSGYDPLHIAAIQGHHAIV EVLLDHDATLSQTFGPSNATPLVSAAMRGHTEVVNQLLSKAGNLLEISRSNNKNALHLAA RQGHVEVIKALLSKDPQLARRIDKKGQTALHMAVKGQSSEVVKLLLDADPAIVMQPDKSC NTALHVATRKKRAEIVELLLSLPDTNANTLTRDHKTALDIAEGLPLSEESSYIKECLARS GALRANELNQPRDELRSTVTQIKNDVHIQLEQTKRTNKNVHNISKELRKLHREGINNATN SVTVVAVLFATVAFAAIFTVPGGDNNDGSAVVVGRASFKIFFIFNALALFTSLAVVVVQI TLVRGETKAEKRVVEVINKLMWLASMCTSVAFLASSYIVVGRKNEWAAELVTVVGGVIMA GVLGTMTYYVVKSKRTRSMRKKVKSARRSGSNSWHHSDFSNSEVDPIFAI
Uniprot No.

Target Background

Function
This protein plays a role in salt stress tolerance. Its mechanism of action may involve abscisic acid (ABA) signaling pathways and promoting the production of reactive oxygen species (ROS).
Gene References Into Functions
  1. These findings suggest that RTV1 and ITN1 regulate the subcellular localization of each other. PMID: 22664102
Database Links

KEGG: ath:AT3G12360

STRING: 3702.AT3G12360.1

UniGene: At.39610

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in roots, shoots, leaf vasculature and stems.

Q&A

Basic Research Questions

  • What is the basic structure and function of At3g12360 ankyrin repeat-containing protein?

    At3g12360 belongs to the ankyrin repeat-containing protein family in Arabidopsis thaliana. Ankyrin repeats consist of approximately 33 amino acid residues that form a conserved secondary structure. These repeats function as protein-protein interaction domains . The primary structure contains few invariant amino acids, mainly in hydrophobic positions necessary for maintaining the secondary structure. The three-dimensional structure typically features an L-shaped cross-section, with β-hairpins projecting away from helical pairs .

    In Arabidopsis, ankyrin repeat-containing proteins can be classified into 16 structurally similar groups, with At3g12360 belonging to one of these groups . While the specific function of At3g12360 has not been fully characterized, proteins with similar structures in other species participate in various cellular processes, including signal transduction and transcriptional regulation.

  • How can I express recombinant At3g12360 protein in a heterologous system?

    Expression of recombinant At3g12360 can be achieved through several systems, with E. coli being commonly used for initial characterization. Based on methodologies for similar Arabidopsis proteins , a recommended protocol would include:

    Table 1: Protocol for Recombinant At3g12360 Expression in E. coli

    StepProcedureCritical Parameters
    1Clone At3g12360 coding sequence into an expression vector (e.g., pET or pGEX series)Ensure correct reading frame and presence of tag for purification
    2Transform into an appropriate E. coli strain (BL21(DE3) or similar)Use strains optimized for recombinant protein expression
    3Induce expression (typically with IPTG, 0.1-1 mM)Optimize temperature (16-37°C) and induction time (3-16 hours)
    4Harvest cells and prepare membrane fractionsMembrane preparation is crucial if At3g12360 associates with membranes
    5Purify protein using affinity chromatographyBased on the fusion tag (His, GST, etc.)

    Verification of the purified protein can be performed using SDS-PAGE followed by MALDI-TOF/TOF analysis, similar to the approach used for other Arabidopsis recombinant proteins .

  • What experimental approaches can verify the subcellular localization of At3g12360?

    To determine the subcellular localization of At3g12360, several complementary approaches can be employed:

    1. Fluorescent protein fusion: Generate constructs with At3g12360 fused to GFP, YFP, or similar fluorescent proteins. This approach has been successfully used for other plant proteins, as demonstrated in studies of ESL1 protein localization .

    2. Transient expression assays: Use Agrobacterium-mediated transformation to express fusion proteins in tobacco leaves or Arabidopsis seedlings .

    3. Stable transformation: Establish stable transgenic Arabidopsis lines expressing the fusion protein under control of native or constitutive promoters.

    4. Co-localization studies: Use known organelle markers (e.g., tonoplast marker VAM3) fused to different fluorescent proteins (CFP) to confirm localization .

    5. Subcellular fractionation: Isolate different cellular compartments and detect the protein using immunoblotting with specific antibodies.

    The fluorescence pattern observed under a laser scanning confocal microscope will help determine whether At3g12360 is associated with the plasma membrane, tonoplast, or other cellular compartments.

  • What are the key considerations for designing primers for At3g12360 cloning?

    When designing primers for cloning At3g12360, several critical factors should be considered:

    1. Sequence verification: Confirm the latest sequence annotation for At3g12360 from reliable databases (e.g., TAIR, NCBI).

    2. Inclusion of restriction sites: Add appropriate restriction enzyme sites compatible with your destination vector, including 3-6 extra bases upstream of the restriction site for efficient enzyme cutting.

    3. Reading frame considerations: Ensure the coding sequence will be in-frame with any fusion tags in the destination vector.

    4. Primer properties:

      • Length: Typically 18-30 nucleotides (excluding restriction sites)

      • GC content: 40-60%

      • Melting temperature (Tm): 55-65°C with less than 5°C difference between forward and reverse primers

      • Avoid secondary structures and primer-dimer formation

    5. Optional elements: Consider adding Kozak sequence for improved expression or removing stop codons for C-terminal fusions.

    Following these guidelines will improve the success rate of At3g12360 amplification and subsequent cloning experiments.

Advanced Research Questions

  • How does recombinant At3g12360 production impact the endoplasmic reticulum (ER) stress response in plant expression systems?

    Recombinant protein production in plants can trigger ER stress and the unfolded protein response (UPR). Studies on seed-specific antibody production demonstrate that even modest levels of recombinant protein can induce ER stress .

    For At3g12360 expression, several UPR markers should be monitored:

    1. Upregulated ER chaperones: BiP, PDI, and CALNEXIN expression levels increase during ER stress .

    2. Translational regulation: P58IPK and other factors controlling protein synthesis may be altered .

    3. Apoptosis-related genes: BAX INHIBITOR1 and similar genes may be upregulated .

    Table 2: UPR Marker Genes for Monitoring During At3g12360 Expression

    Gene CategorySpecific MarkersDetection Method
    ER ChaperonesBiP, PDI, CALNEXINqRT-PCR, Western blot
    Glycosylation/ModificationVarious glycosyl transferasesqRT-PCR, enzyme activity assays
    TranslocationP58IPKqRT-PCR, Western blot
    Vesicle TransportCOPII componentsqRT-PCR, subcellular localization
    Protein DegradationERAD componentsqRT-PCR, proteolytic activity

    Monitoring these markers through transcriptomic (microarray or RNA-seq) and proteomic approaches can help assess the impact of At3g12360 expression on cellular homeostasis and optimize expression conditions to minimize detrimental effects .

  • What statistical approaches are most appropriate for analyzing differential expression of At3g12360 under abiotic stress conditions?

    Analysis of At3g12360 expression under abiotic stress conditions requires robust statistical approaches to account for biological variation and experimental design considerations:

    1. Experimental design: Implement a completely randomized block design with adequate biological replicates (minimum 3-5) to assess variation properly . This is crucial for toxicogenomic experiments where power calculations are often limited by uncertainties in assay and population variability .

    2. Normalization methods: For transcriptomic data (RNA-seq or microarray), normalize using appropriate methods:

      • For microarray data: RMA or GCRMA normalization

      • For RNA-seq: TPM, RPKM, or DESeq2 normalization

    3. Statistical tests for differential expression:

      • For microarray data: Use SAM (Significant Analysis of Microarrays) with a False Discovery Rate threshold p-value <0.01

      • For RNA-seq data: Apply DESeq2 or edgeR packages, which account for biological variance

    4. Multiple testing correction: Apply Benjamini-Hochberg procedure to control false discovery rate when making multiple comparisons.

    5. Validation: Confirm expression changes through RT-qPCR using appropriate reference genes (e.g., actin, GAPDH) that remain stable under the tested stress conditions .

    For analyzing At3g12360 specifically, consider setting a fold-change cutoff (typically 1.5-2 fold) in addition to statistical significance to identify biologically meaningful changes in expression.

  • How can I design experiments to identify protein interaction partners of At3g12360?

    Given that ankyrin repeat domains function as protein-protein interaction modules, characterizing the interactome of At3g12360 is critical for understanding its function. Multiple complementary approaches should be employed:

    1. Yeast Two-Hybrid (Y2H) Screening:

      • Use At3g12360 as bait against an Arabidopsis cDNA library

      • Consider using both full-length protein and isolated ankyrin repeat domains

      • Implement appropriate controls to eliminate false positives

      • Verify interactions through directed Y2H assays

    2. Co-Immunoprecipitation (Co-IP):

      • Generate transgenic Arabidopsis plants expressing tagged At3g12360

      • Perform Co-IP followed by mass spectrometry to identify interacting proteins

      • Validate specific interactions using targeted Western blotting

    3. Bimolecular Fluorescence Complementation (BiFC):

      • Fuse At3g12360 and candidate interactors to complementary fragments of fluorescent proteins (e.g., YFP)

      • Express in plant cells (protoplasts or N. benthamiana leaves)

      • Confirm interactions through reconstitution of fluorescence

    4. Proximity-Dependent Biotin Identification (BioID):

      • Fuse At3g12360 to a biotin ligase

      • Express in Arabidopsis to biotinylate proximal proteins

      • Identify labeled proteins via streptavidin pulldown and mass spectrometry

    These approaches should be complemented with bioinformatic analyses to identify interaction domains and predict potential interactors based on structural features of ankyrin repeat domains.

  • What approaches can resolve contradictory data regarding the function of At3g12360 in plant stress responses?

    Contradictory data about At3g12360 function can arise from differences in experimental conditions, genetic backgrounds, or technical approaches. To resolve such contradictions:

    1. Systematic comparison of experimental conditions:

      • Create a comprehensive table documenting all variables: plant age, growth conditions, treatment durations, concentrations, etc.

      • Identify critical differences that might explain discrepancies

    2. Genetic analysis using multiple alleles:

      • Characterize multiple T-DNA insertion lines affecting At3g12360

      • Create CRISPR/Cas9 knockout lines to ensure complete loss of function

      • Complement mutants with the wild-type gene to confirm phenotype rescue

      • Analyze double mutants with related genes to identify genetic interactions

    3. Tissue-specific and developmental analysis:

      • Use promoter-reporter fusions to precisely define expression patterns

      • Implement tissue-specific or inducible expression systems

      • Analyze function at different developmental stages

    4. Multi-omics integration:

      • Combine transcriptomic, proteomic, and metabolomic data

      • Apply statistical methods like correlation analysis between datasets

      • Use network analysis to place At3g12360 in functional pathways

    5. Cross-species validation:

      • Compare function with homologs in other plant species, particularly those with well-characterized ankyrin proteins in Nicotiana tabacum

    Creating a comprehensive experimental framework that addresses all these aspects will help resolve contradictions and provide a more accurate understanding of At3g12360 function.

  • How can I optimize microarray or RNA-seq experimental design to study At3g12360 expression across different tissues and conditions?

    Optimizing transcriptomic experiments for studying At3g12360 requires careful consideration of several factors:

    1. Sampling strategy:

      • Include multiple biological replicates (minimum 3, preferably 5-6) to account for biological variation

      • Harvest tissues at consistent developmental stages and time points

      • Consider diurnal variation in gene expression when planning harvest times

      • Use precise tissue micro-dissection techniques for tissue-specific analysis

    2. RNA quality control:

      • Verify RNA integrity (RIN > 8) before library preparation

      • Check for DNA contamination

      • Assess RNA purity (A260/A280 and A260/A230 ratios)

    3. Technology selection:

      • Microarrays: Use tiling arrays (e.g., Arabidopsis Tiling 1.0R) that provide better coverage compared to traditional ATH1 arrays

      • RNA-seq: Consider strand-specific sequencing with sufficient depth (20-30M reads per sample)

    4. Experimental design considerations:

      • Include appropriate controls for each condition and tissue type

      • Incorporate spike-in controls for normalization

      • Randomize samples during processing to avoid batch effects

    5. Data analysis pipeline:

      • For microarrays: Normalize using RMA or GCRMA methods

      • For RNA-seq: Apply appropriate normalization methods (DESeq2, edgeR)

      • Use statistical testing with multiple testing correction

      • Validate key findings using RT-qPCR

    This approach will provide robust data on At3g12360 expression patterns and responses to environmental stimuli.

  • What methodologies can elucidate the relationship between At3g12360 structure and function?

    Structure-function analysis of At3g12360 requires a multi-faceted approach to connect specific structural elements with biological activities:

    1. Structural analysis:

      • Homology modeling based on known ankyrin repeat structures

      • X-ray crystallography or cryo-EM of purified protein

      • NMR studies of individual ankyrin repeat domains

    2. Mutagenesis approaches:

      • Alanine-scanning mutagenesis of conserved residues, similar to methods used for studying ESL1 localization

      • Creation of deletion variants lacking specific ankyrin repeats

      • Domain swapping with related ankyrin proteins

    Table 3: Structure-Function Analysis Pipeline for At3g12360

    ApproachMethodologyExpected Outcome
    In silico analysisSequence alignment, homology modelingIdentification of critical residues and domains
    MutagenesisSite-directed mutagenesis, alanine scanningCorrelation of specific residues with function
    Protein expressionE. coli, yeast, or plant expression systemsProduction of variants for functional testing
    Localization studiesConfocal microscopy of fluorescent fusionsEffect of mutations on subcellular targeting
    Interaction assaysY2H, BiFC, Co-IPImpact of mutations on protein-protein interactions
    Functional assaysStress response, developmental phenotypesBiological significance of structural elements
    1. Biophysical characterization:

      • Circular dichroism (CD) spectroscopy to assess secondary structure

      • Surface plasmon resonance (SPR) to measure interaction kinetics with partners

      • Thermal shift assays to evaluate protein stability

    2. In vivo validation:

      • Complementation of knockout mutants with structure-based variants

      • Analysis of developmental and stress-response phenotypes

      • Assessment of protein-protein interactions in planta

    This comprehensive approach will provide insights into how the ankyrin repeat structure of At3g12360 relates to its biological function in Arabidopsis.

  • How can CRISPR/Cas9 genome editing be optimized for studying At3g12360 function?

    CRISPR/Cas9 editing provides powerful tools for functional analysis of At3g12360 through creation of precise mutations. An optimized approach includes:

    1. sgRNA design considerations:

      • Target conserved regions within ankyrin repeat domains

      • Design multiple sgRNAs targeting different exons

      • Evaluate off-target potential using plant-specific prediction tools

      • Ensure high on-target efficiency scores

    2. Delivery methods:

      • Agrobacterium-mediated transformation for stable integration

      • Protoplast transfection for rapid screening of sgRNA efficiency

      • Consider egg cell-specific promoters for germline editing

    3. Editing strategies beyond knockout:

      • Base editing for introducing specific amino acid changes

      • Prime editing for precise sequence modifications

      • Multiplex editing to target multiple ankyrin repeats simultaneously

      • Knock-in approaches to introduce reporter tags at the endogenous locus

    4. Screening methodology:

      • Design PCR primers flanking target sites

      • Implement T7E1 or Surveyor assays for initial screening

      • Confirm mutations by Sanger sequencing

      • Use deep sequencing for comprehensive mutation analysis

    5. Phenotypic characterization:

      • Compare multiple independent lines to control for off-target effects

      • Evaluate developmental phenotypes under standard conditions

      • Test responses to various abiotic stresses

      • Analyze expression of UPR marker genes to assess cellular stress

    This approach allows creation of targeted modifications to study specific aspects of At3g12360 function with precision not possible using traditional T-DNA insertion lines.

  • What are the most effective experimental designs for studying the role of At3g12360 in plant stress responses?

    To comprehensively evaluate At3g12360's role in stress responses, implement a multi-faceted experimental design:

    1. Genetic materials preparation:

      • Generate multiple independent transgenic lines (overexpression, RNAi, CRISPR/Cas9)

      • Include appropriate controls (empty vector, non-edited plants)

      • Consider tissue-specific or inducible expression systems

    2. Stress treatment design:

      • Apply stress treatments (drought, salt, temperature, pathogen) with precise control of intensity and duration

      • Include both acute and chronic stress regimes

      • Implement recovery phases to assess resilience

      • Consider combined stresses to mimic natural conditions

    Table 4: Recommended Experimental Design for Stress Response Studies

    Experimental FactorDescriptionRationale
    Genetic MaterialsWild-type, knockout, overexpression, complementation linesComprehensive genetic analysis
    Developmental StagesSeedling, mature vegetative, reproductiveIdentify stage-specific responses
    Stress TypesDrought, salt, heat, cold, pathogenDetermine stress specificity
    Stress IntensityMultiple levels (mild, moderate, severe)Establish dose-response relationships
    Temporal AnalysisEarly (hours) and late (days) responsesDistinguish primary and secondary effects
    Tissue TypesRoots, leaves, stems, reproductive organsIdentify tissue-specific roles
    1. Multi-level phenotyping:

      • Physiological measurements (photosynthesis, stomatal conductance, water potential)

      • Biochemical analyses (ROS production, antioxidant enzyme activities)

      • Molecular responses (target gene expression, protein accumulation)

      • Subcellular changes (membrane integrity, organelle morphology)

    2. Data analysis approach:

      • Implement appropriate statistical designs (completely randomized block design)

      • Use repeated measures ANOVA for time-course experiments

      • Apply multivariate analysis to integrate diverse datasets

      • Ensure adequate replication (minimum n=5 for each condition)

    This comprehensive approach will elucidate At3g12360's specific contributions to stress responses while minimizing confounding variables.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.