Recombinant Arabidopsis thaliana Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Description

Introduction

Apocytochrome f (petA) is a vital component of the cytochrome $$b_6f$$ complex found in the thylakoid membranes of chloroplasts in plants and algae . This complex plays a crucial role in photosynthetic electron transport, linking Photosystem II to Photosystem I and contributing to the generation of a proton gradient that drives ATP synthesis . In Arabidopsis thaliana, petA is encoded by the chloroplast genome, and its expression and assembly into the cytochrome $$b_6f$$ complex are tightly regulated by nuclear-encoded factors .

Gene and Protein Structure

The petA gene encodes apocytochrome f precursor, which undergoes processing to produce the mature apocytochrome f protein . The Arabidopsis thaliana AtCCMH protein, essential for c-type cytochrome maturation, shares 20-25% identity with CycL, Ccl2, and CcmH proteins from Bradyrhizobium japonicum, Rhodobacter capsulatus, and Rhodobacter sphaeroides, respectively . The mature transcript encodes a 159 amino acid protein, featuring hydrophilic domains D1 and D2 separated by a hydrophobic domain and a conserved RCXXC motif in the D1 domain .

Role in Photosynthesis

Apocytochrome f is a subunit of the cytochrome $$b_6f$$ complex, which mediates electron transfer between Photosystem II and Photosystem I . The complex oxidizes plastoquinol and reduces plastocyanin, facilitating the transfer of electrons and pumping protons into the thylakoid lumen, thereby establishing a proton gradient . This gradient is essential for ATP synthesis via ATP synthase .

Regulation of petA Expression

The expression of petA is subject to intricate regulation at both the transcriptional and translational levels. Several nuclear-encoded factors are involved in petA mRNA processing and translation . For instance, TCA1 (translation of cytochrome $$b_6f$$ petA mRNA) is a nuclear gene encoding a translational activator specific for petA mRNA in Chlamydomonas reinhardtii chloroplasts .

Mutants and Phenotypes

Mutants with disruptions in petA or related regulatory genes exhibit various photosynthetic defects. For example, the hcf152 mutant in Arabidopsis thaliana shows altered expression of the chloroplast petA gene . Similarly, knockout plants for AtCCMH, which interacts with apocytochrome c, display lethality at the torpedo stage of embryogenesis due to severe cellular disorder, highlighting the importance of cytochrome maturation for plant development .

Recombinant Apocytochrome f

Recombinant apocytochrome f can be produced using various expression systems to facilitate in vitro studies of its structure, function, and interactions with other proteins.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and inherent protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag type, please specify this in your order; we will prioritize fulfillment accordingly, subject to feasibility.
Synonyms
petA; AtCg00540; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
petA
Target Protein Sequence
YPIFAQQNYENPREATGRIVCANCHLANKPVDIEVPQTVLPDTVFEAVVKIPYDMQLKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQNYRPNKKNILVIGPVPG QKYSEITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIIS KILRKEKGGYEITIVDASNGREVIDIIPRGLELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function

Recombinant Arabidopsis thaliana Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitates cyclic electron flow around PSI, and plays a role in state transitions.

Database Links
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

Advanced Research Questions

  • How do mutations in petA affect photosynthetic electron transport in Arabidopsis?

Mutations in petA have profound effects on photosynthetic electron transport through multiple mechanisms:

  • Complex Assembly Disruption: Mutations in petA can prevent proper assembly of the cytochrome b6/f complex, leading to complete loss of complex function. This results in a block in linear electron transport between photosystems II and I .

  • Embryo Development Impact: Homozygous ccmh/ccmh mutants (affecting cytochrome c maturation) show arrested embryo development at the torpedo stage, demonstrating that disruption of electron transport components leads to severe developmental defects .

  • High Chlorophyll Fluorescence Phenotype: Plants with petA mutations typically exhibit a high chlorophyll fluorescence (HCF) phenotype, indicating accumulated excitation energy that cannot be properly utilized due to blocked electron transport .

  • Post-Translational Effects: Research indicates that mutations often act post-translationally by interfering with the assembly of the complex rather than affecting transcription or translation of the components .

  • Compensatory Responses: Plants with petA mutations may show upregulation of alternative electron transport pathways as a compensatory mechanism, though these cannot fully replace the function of the cytochrome b6/f complex .

The study of these mutations provides valuable insights into both the function of Apocytochrome f and the assembly process of the cytochrome b6/f complex.

  • What methodological approaches are most effective for studying Apocytochrome f function?

Several complementary approaches have proven effective for investigating Apocytochrome f function:

  • Genetic Approaches:

    • T-DNA insertion mutants for studying loss-of-function phenotypes

    • Site-directed mutagenesis to study specific functional domains

    • CRISPR/Cas9 genome editing for precise modifications

  • Biochemical Techniques:

    • Isolation of thylakoid membranes and protein complexes

    • Blue-native PAGE for studying intact complexes

    • Immunoprecipitation to study protein-protein interactions

  • Biophysical Methods:

    • Electron paramagnetic resonance (EPR) spectroscopy to study redox properties

    • Surface plasmon resonance (SPR) for interaction studies

    • Circular dichroism for structural analysis

  • Proteomics Approaches:

    • iTRAQ analysis for quantitative proteomics

    • Mass spectrometry for post-translational modification identification

    • Cross-linking mass spectrometry for structural studies

  • Imaging Techniques:

    • Transmission electron microscopy to visualize complex assembly

    • Confocal microscopy with fluorescent tags to study localization

    • Super-resolution microscopy for detailed structural analysis

  • Computational Methods:

    • Molecular dynamics simulations to study protein dynamics

    • Homology modeling for structural predictions

    • Phylogenetic analysis for evolutionary studies

An integrated approach combining these methods yields the most comprehensive understanding of Apocytochrome f function.

  • How does post-translational modification affect Apocytochrome f assembly and function?

Post-translational modifications play crucial roles in Apocytochrome f assembly and function:

  • Disulfide Bond Formation:

    • The HCF164 gene encodes a thioredoxin-like protein with disulfide reductase activity that is essential for cytochrome b6/f complex assembly

    • Proper disulfide bond formation is critical for the structural integrity of Apocytochrome f

  • Heme Attachment:

    • Apocytochrome f requires covalent attachment of heme c for function

    • The process involves specific enzymes including those encoded by ccmH (cytochrome c maturation)

    • Mutations in these pathways prevent proper heme incorporation

  • Membrane Integration:

    • Proper integration into the thylakoid membrane requires specific chaperones

    • The mature protein is anchored to the thylakoid membrane at its lumenal side

  • Protein-Protein Interactions:

    • Assembly into the functional cytochrome b6/f complex requires specific interaction surfaces

    • Post-translational modifications can affect these interaction capabilities

  • Redox Regulation:

    • The functional state of Apocytochrome f is influenced by the redox environment

    • Thioredoxin-mediated modifications respond to changing cellular conditions

Research indicates that these post-translational modifications are often the targets of regulatory mechanisms that adjust photosynthetic electron transport in response to environmental conditions.

  • How does Apocytochrome f structure compare across different plant species?

Comparative analysis of Apocytochrome f across plant species reveals important evolutionary insights:

This cross-species conservation makes Apocytochrome f an excellent model for studying fundamental aspects of photosynthetic electron transport.

  • What role does Apocytochrome f play in stress responses in Arabidopsis?

Research has revealed several ways in which Apocytochrome f contributes to stress responses:

  • Oxidative Stress:

    • The cytochrome b6/f complex can be both a target and a source of reactive oxygen species (ROS)

    • Alterations in Apocytochrome f function affect the plant's ability to manage oxidative stress

  • Light Stress Responses:

    • The cytochrome b6/f complex participates in regulating electron flow under high light conditions

    • This regulation helps prevent over-reduction of the electron transport chain and excessive ROS production

  • Programmed Cell Death:

    • Perturbations in electron transport components, including cytochromes, are involved in signaling pathways that can trigger programmed cell death

    • Release of cytochrome c from mitochondria is observed during programmed cell death, suggesting parallel mechanisms may exist for chloroplast cytochromes

  • Environmental Adaptation:

    • QTL mapping studies have identified regions containing electron transport genes (potentially including petA) that contribute to adaptation to different light environments

  • Temperature Stress:

    • The stability and function of the cytochrome b6/f complex are affected by temperature extremes

    • Modifications in Apocytochrome f expression or structure may contribute to temperature stress tolerance

Understanding these roles provides insights into how photosynthetic electron transport contributes to plant stress resilience.

  • How can recombinant Apocytochrome f be used as a tool in photosynthesis research?

Recombinant Apocytochrome f serves multiple purposes in photosynthesis research:

  • Standard for Quantification:

    • Acts as a reference standard in immunoblot analyses for quantifying native protein levels

    • Enables precise measurement of changes in protein abundance under various conditions

  • Structural Studies:

    • Provides material for crystallography or cryo-EM studies

    • Allows investigation of protein dynamics through biophysical approaches

  • Protein-Protein Interaction Analysis:

    • Serves as bait in pull-down assays to identify interaction partners

    • Can be used in surface plasmon resonance (SPR) to measure binding kinetics with other components of the photosynthetic apparatus

  • Antibody Production:

    • Used as an antigen for generating specific antibodies

    • These antibodies become valuable tools for detecting the protein in various experimental contexts

  • In vitro Reconstitution Studies:

    • Enables reconstitution of partial or complete cytochrome b6/f complexes

    • Allows detailed study of electron transfer mechanisms in controlled environments

  • Teaching Tool:

    • Serves as a model system for demonstrating principles of electron transport

    • Useful in laboratory courses focusing on photosynthesis and protein biochemistry

This versatility makes recombinant Apocytochrome f an invaluable resource in photosynthesis research.

  • What are the challenges in expressing functional recombinant Apocytochrome f?

Researchers face several significant challenges when producing functional recombinant Apocytochrome f:

  • Membrane Protein Expression:

    • As a membrane-associated protein, Apocytochrome f can be difficult to express in soluble, correctly folded form

    • Expression systems often require optimization of detergents or membrane mimetics

  • Cofactor Incorporation:

    • Proper incorporation of the heme cofactor is essential for function

    • Expression systems may lack the necessary machinery for correct heme attachment

  • Post-translational Modifications:

    • Bacterial expression systems may not perform the same post-translational modifications as plant chloroplasts

    • This can affect protein folding, stability, and function

  • Protein Stability:

    • The protein may be unstable when removed from its native membrane environment

    • Storage conditions require careful optimization to maintain functionality

  • Heterologous Expression Toxicity:

    • Expression of membrane proteins can be toxic to host cells

    • This necessitates careful control of expression levels and conditions

  • Purification Challenges:

    • Purification must balance the need to remove contaminants while maintaining the native state

    • Detergent selection is critical for membrane protein purification

  • Functional Assessment:

    • Confirming that the recombinant protein retains native electron transport capabilities requires specialized assays

    • These assays must often be adapted for in vitro conditions

Overcoming these challenges typically requires iterative optimization of expression and purification protocols.

  • How has genomic analysis advanced our understanding of petA evolution and function?

Genomic analysis has provided significant insights into petA evolution and function:

  • Evolutionary Conservation:

    • Comparative genomics reveals that petA is highly conserved across photosynthetic organisms

    • This conservation reflects its essential role in photosynthesis

  • Recombination Patterns:

    • Analysis of recombination patterns in Arabidopsis has shown that chloroplast genes, including petA, have distinct evolutionary histories

    • Recombination hotspots are enriched in intergenic regions and repetitive DNA, which affects the evolution of genes like petA

  • Selection Pressure:

    • Genome-wide selection scans have identified signatures of selection acting on photosynthetic genes

    • These analyses help identify functionally important regions of petA

  • Structural Insights:

    • Genomic comparisons across species inform structural predictions for Apocytochrome f

    • Conserved residues often correlate with functionally critical regions

  • Genetic Architecture:

    • QTL mapping has linked regions containing photosynthetic genes to phenotypic variation

    • This helps understand how genetic variation in these genes contributes to adaptation

  • Regulatory Networks:

    • Genomic studies reveal the regulatory networks controlling petA expression

    • These networks coordinate nuclear and chloroplast gene expression

This genomic perspective continues to enhance our understanding of how petA function is integrated within the broader context of plant physiology.

  • What techniques are available for studying Apocytochrome f interactions with other proteins in the thylakoid membrane?

Several sophisticated techniques can be employed to study Apocytochrome f interactions:

  • Blue-Native PAGE:

    • Allows separation of intact protein complexes

    • Can be combined with second-dimension SDS-PAGE to identify complex components

    • Useful for comparing complex assembly in wild-type and mutant plants

  • Co-immunoprecipitation:

    • Uses antibodies against Apocytochrome f to pull down interaction partners

    • Can identify both stable and transient interactions

    • Often combined with mass spectrometry for protein identification

  • Surface Plasmon Resonance (SPR):

    • Provides real-time measurement of binding kinetics

    • Can determine association and dissociation rates

    • Allows testing of recombinant proteins under various conditions

  • Förster Resonance Energy Transfer (FRET):

    • Measures energy transfer between fluorescently labeled proteins

    • Can detect interactions in living cells

    • Provides information about proximity and orientation

  • Cross-linking Mass Spectrometry:

    • Uses chemical cross-linkers to capture interacting proteins

    • Mass spectrometry identifies the cross-linked peptides

    • Provides structural information about interaction interfaces

  • Yeast Two-Hybrid and Split-Ubiquitin Systems:

    • Genetic methods to detect protein-protein interactions

    • Split-ubiquitin particularly useful for membrane proteins

    • Can screen libraries to identify novel interaction partners

  • Cryo-Electron Microscopy:

    • Provides structural information about protein complexes in near-native states

    • Can reveal the precise arrangement of components within the cytochrome b6/f complex

    • Increasingly becoming the method of choice for studying membrane protein complexes

These approaches provide complementary information about the interaction network of Apocytochrome f.

  • How do different expression systems affect the properties of recombinant Apocytochrome f?

Different expression systems produce recombinant Apocytochrome f with varying properties:

Expression SystemAdvantagesLimitationsProtein Characteristics
E. coli- High yield
- Cost-effective
- Easy genetic manipulation
- Rapid growth
- Limited post-translational modifications
- Inclusion body formation common
- Challenges with membrane proteins
- Often requires refolding
- May lack proper heme incorporation
- Typically requires solubilization tags
Yeast- Eukaryotic post-translational modifications
- Higher expression of membrane proteins
- Scalable culture
- Glycosylation patterns differ from plants
- Lower yields than E. coli
- More complex media requirements
- Better folding than E. coli
- Improved membrane integration
- Partial post-translational modifications
Insect Cells- Advanced eukaryotic modifications
- Good for membrane proteins
- Near-native protein folding
- Expensive
- Complex culture conditions
- Technical expertise required
- High-quality protein
- Good membrane integration
- More native-like structure
Plant Expression- Most native-like modifications
- Proper cofactor incorporation
- Correct folding environment
- Lower yields
- Longer production time
- Complex purification
- Most functionally authentic
- Correct heme incorporation
- Native membrane integration
Cell-Free Systems- Rapid production
- Avoids toxicity issues
- Direct incorporation of modified amino acids
- Expensive
- Limited scale
- Technical complexity
- Variable quality- Customizable modifications- Useful for difficult proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.