Recombinant Arabidopsis thaliana Aquaporin NIP1-2 (NIP1-2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana Aquaporin NIP1-2 (NIP1-2)

NIP1-2 is a plasma membrane-localized aquaporin from Arabidopsis thaliana, belonging to the nodulin-26-like intrinsic protein (NIP) subfamily. It plays a critical role in aluminum (Al) tolerance by facilitating the transport of aluminum-malate complexes from root cell walls into the symplasm and enabling root-to-shoot translocation of Al . Recombinant NIP1-2 is expressed in E. coli as a full-length protein (1–294 amino acids) fused with an N-terminal His tag for purification and structural studies .

Functional Role in Aluminum Tolerance

NIP1-2 operates as an Al-malate transporter, coordinating with the Al-activated malate efflux transporter ALMT1 to detoxify roots by removing Al from cell walls. Key findings include:

  • Al-Malate Transport: NIP1-2 specifically transports the Al-malate complex, not free Al³⁺ ions .

  • Root-to-Shoot Translocation: Mutant nip1;2 plants show impaired Al translocation to shoots, leading to hyperaccumulation in root cell walls .

  • Dependency on ALMT1: Malate exudation by ALMT1 is essential for Al-malate complex formation, a prerequisite for NIP1-2 activity .

ParameterWild Type (WT)nip1;2 Mutant
Al in Root Cell WallsModerate accumulationHyperaccumulation
Root-to-Shoot Al TranslocationEfficientSignificantly reduced
Root Symplasm Al ContentNormal levelsLower concentrations

Mechanism of Action

  1. Al-Malate Transport: NIP1-2 facilitates bidirectional transport of Al-malate across the plasma membrane, enabling Al removal from apoplastic spaces .

  2. Xylem Loading: Al-malate complexes are loaded into xylem vessels for translocation to shoots, mitigating root toxicity .

  3. Tissue-Specific Expression: NIP1;2 transcripts are enriched in root tips, where Al toxicity is most acute .

Mutant Phenotypes

  • Al Toxicity Sensitivity: nip1;2 mutants exhibit stunted root growth and reduced survival under Al stress .

  • Impaired Symplasmic Al Uptake: ICP-MS analysis shows lower Al concentrations in root symplasm compared to WT .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order remarks. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
NIP1-2; NLM2; At4g18910; F13C5.80; Aquaporin NIP1-2; NOD26-like intrinsic protein 1-2; AtNIP1;2; Nodulin-26-like major intrinsic protein 2; NodLikeMip2; Protein NLM2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-294
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
NIP1-2
Target Protein Sequence
MAEISGNGGDARDGAVVVNLKEEDEQQQQQQAIHKPLKKQDSLLSISVPFLQKLMAEVLGTYFLIFAGCAAVAVNTQHDKAVTLPGIAIVWGLTVMVLVYSLGHISGAHFNPAVTIAFASCGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDQDVCSGKHDVFVGTLPSGSNLQSFVIEFIITFYLMFVISGVATDNRAIGELAGLAVGSTVLLNVIIAGPVSGASMNPGRSLGPAMVYSCYRGLWIYIVSPIVGAVSGAWVYNMVRYTDKPLREITKSGSFLKTVRNGSSR
Uniprot No.

Target Background

Function
This water channel is likely essential for promoting glycerol permeability and water transport across cell membranes.
Gene References Into Functions
  1. The NIP1;2-mediated Aluminum (Al) uptake system is crucial for Al resistance in Arabidopsis. PMID: 29293394
  2. These findings reveal a critical link between the previously identified Al exclusion mechanism based on root malate release and an internal Al tolerance mechanism. This mechanism involves the coordinated function of NIP1;2 and ALMT1, which is necessary for Al removal from the root cell wall, root-to-shoot Al translocation, and overall Al tolerance in Arabidopsis. PMID: 28439024
Database Links

KEGG: ath:AT4G18910

STRING: 3702.AT4G18910.1

UniGene: At.1953

Protein Families
MIP/aquaporin (TC 1.A.8) family, NIP (TC 1.A.8.12) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in developing seeds.

Q&A

What is NIP1;2 and what is its fundamental function in Arabidopsis thaliana?

NIP1;2 is a plasma membrane-localized member of the Arabidopsis nodulin 26-like intrinsic protein (NIP) subfamily of the aquaporin (AQP) family. Its primary function is to facilitate aluminum-malate (Al-malate) transport from the root cell wall into the root symplasm, with subsequent Al xylem loading and root-to-shoot translocation. This transport activity represents a critical step in an internal aluminum tolerance mechanism in Arabidopsis . Unlike other aquaporins that primarily transport water, NIP1;2 has evolved specialized transport capabilities for metal-organic acid complexes, specifically aluminum bound to malate .

The protein functions as part of a coordinated system that helps plants cope with aluminum toxicity in acidic soils. While many studies have focused on the external aluminum exclusion mechanisms in plants, NIP1;2 represents a component of the internal detoxification pathway that works in concert with external defense mechanisms .

How does NIP1;2 contribute to aluminum tolerance in Arabidopsis?

NIP1;2 contributes to aluminum tolerance through two primary mechanisms:

  • Removal of Al from root cell walls: NIP1;2 facilitates the transport of Al-malate complexes from the root cell wall into the root cytosol, reducing toxic Al accumulation in the apoplast. This function helps prevent cell wall damage and growth inhibition caused by Al toxicity .

  • Root-to-shoot Al translocation: After facilitating Al uptake into the root symplasm, NIP1;2 is involved in Al xylem loading, enabling root-to-shoot translocation of Al. This process is important for removing Al from sensitive root tissues and sequestering it in less sensitive shoot tissues .

What expression pattern does NIP1;2 exhibit in Arabidopsis roots?

NIP1;2 shows a tissue-specific expression pattern primarily localized to the root tips, which are the most Al-sensitive regions of the root. This localization is consistent with its role in protecting the actively growing root apex from Al toxicity .

Importantly, NIP1;2 expression is enhanced specifically by aluminum stress but not by other metal stresses such as cadmium (Cd²⁺), lanthanum (La³⁺), zinc (Zn²⁺), and copper (Cu²⁺) . This Al-specific induction suggests a specialized role in Al detoxification rather than a general heavy metal tolerance mechanism.

Unlike some other Al tolerance genes in Arabidopsis, NIP1;2 expression is not controlled by STOP1, a master transcription factor that regulates many key Al tolerance genes including ALMT1, MATE, and ALS3 . This indicates that NIP1;2 is regulated through a different signaling pathway, which may provide opportunities for manipulating Al tolerance through multiple independent regulatory systems.

What phenotypes do nip1;2 mutants exhibit compared to wild-type plants?

The nip1;2 mutants display several distinct phenotypes that reveal the importance of this transporter in Al tolerance:

  • Hypersensitivity to Al stress: Three independent NIP1;2 T-DNA insertion lines (nip1;2-1, nip1;2-2, and nip1;2-3) show increased sensitivity to a range of Al concentrations. This hypersensitivity is specific to Al and does not extend to other toxic metal ions such as Cd²⁺, La³⁺, Zn²⁺, and Cu²⁺ .

  • Hyperaccumulation of Al in root cell walls: Compared to wild-type plants, nip1;2 mutants accumulate significantly higher concentrations of Al in their root cell walls, particularly in the root tip region, as demonstrated by hematoxylin staining and ICP-MS analysis .

  • Reduced Al concentrations in the root symplasm: In contrast to elevated cell wall Al, nip1;2 mutants show significantly lower Al concentrations in their root cell sap (symplasm) after Al treatment, confirming NIP1;2's role in facilitating Al uptake from the cell wall into the cytosol .

  • Inhibited root-to-shoot Al translocation: The mutants show reduced capacity for translocating Al from roots to shoots, resulting in altered Al distribution patterns throughout the plant .

While nip1;2 mutants show pronounced Al sensitivity, they are less sensitive than almt1 knockout mutants when exposed to the same range of Al concentrations, suggesting that the external exclusion mechanism mediated by ALMT1 provides the first line of defense against Al toxicity .

What is the molecular mechanism by which NIP1;2 facilitates Al-malate transport?

NIP1;2 specifically facilitates the transport of aluminum-malate complexes rather than free Al³⁺ ions. This selectivity is critical for understanding its function in Al detoxification. Studies in both yeast and Arabidopsis have confirmed that NIP1;2 cannot transport free Al³⁺ ions .

The formation of Al-malate complexes in the root tip apoplast is a prerequisite for NIP1;2-mediated Al removal from the root cell wall. This process depends on a functional root malate exudation system mediated by the aluminum-activated malate transporter, ALMT1. Once malate is released into the apoplast by ALMT1, it forms complexes with Al³⁺ ions, creating the substrate that can be transported by NIP1;2 .

This selective transport of metal-organic acid complexes rather than free metal ions represents an important adaptation that allows plants to manage potentially toxic metals. By only transporting Al in its chelated form, NIP1;2 may help minimize the cellular toxicity of internalized Al.

The molecular basis for this selectivity likely involves specific structural features of the NIP1;2 protein channel that accommodate the dimensions and chemical properties of Al-malate complexes while excluding free Al³⁺ ions. Further structural studies would be valuable for elucidating the precise mechanisms of substrate recognition and transport.

What is the relationship between NIP1;2 and other aluminum tolerance mechanisms in plants?

NIP1;2 represents one component in a complex network of aluminum tolerance mechanisms in plants. The relationship between these mechanisms can be summarized as follows:

  • Complementary to exclusion mechanisms: While Al exclusion through organic acid exudation (via ALMT1 and MATE transporters) serves as the first line of defense, NIP1;2 provides an internal tolerance mechanism that works in concert with these exclusion strategies .

  • Different regulatory pathways: Unlike ALMT1, MATE, and ALS3, which are regulated by the STOP1 transcription factor, NIP1;2 expression is not affected by the loss-of-function stop1 mutation. This indicates that NIP1;2 is controlled by a different regulatory pathway .

  • Linkage between external and internal detoxification: NIP1;2 creates a functional bridge between external Al exclusion and internal Al tolerance mechanisms, highlighting the integrated nature of plant Al tolerance systems .

  • Species-specific adaptations: While the NIP1;2-mediated internal detoxification mechanism has been characterized in Arabidopsis, different plant species may have evolved variations of this system or alternative mechanisms for internal Al tolerance .

Understanding these relationships is crucial for developing comprehensive strategies to improve crop Al tolerance, particularly for agriculture on acidic soils where Al toxicity significantly limits productivity.

How can the transport kinetics of NIP1;2 be characterized experimentally?

Characterizing the transport kinetics of NIP1;2 requires sophisticated experimental approaches that can quantify the movement of Al-malate complexes across membranes. Key methodological approaches include:

  • Heterologous expression systems: Express NIP1;2 in systems such as Xenopus oocytes, yeast, or liposomes where background transport activities are minimal or well-characterized .

  • Isotope tracing: Use isotopically labeled Al (²⁶Al) to track the movement of Al across membranes in systems expressing NIP1;2.

  • Concentration-dependent uptake assays: Measure Al uptake rates across a range of Al-malate concentrations to determine Km and Vmax values that characterize the affinity and capacity of NIP1;2 for its substrate.

  • pH-dependent studies: Examine how transport activity varies with pH, which is particularly relevant given that Al toxicity is primarily a problem in acidic soils.

  • Inhibitor studies: Test the effects of various channel blockers or competitive inhibitors on NIP1;2-mediated transport to further characterize its transport mechanism.

  • Site-directed mutagenesis: Create variants of NIP1;2 with modifications to key residues to identify amino acids essential for substrate recognition and transport.

These approaches can provide detailed insights into the kinetic properties of NIP1;2, including its substrate specificity, transport rate, and regulatory mechanisms.

What techniques can be used to visualize and quantify aluminum accumulation in plant tissues?

Several complementary techniques can be employed to visualize and quantify aluminum accumulation in plant tissues:

  • Hematoxylin staining: This histochemical method provides a rapid visual assessment of Al accumulation in root tissues. Hematoxylin binds to Al and produces a purple-blue color, with staining intensity roughly proportional to Al concentration. In Arabidopsis studies, hematoxylin staining revealed stronger and more expanded staining in the root tip region of nip1;2 mutants compared to wild-type plants, indicating hyperaccumulation of Al in the root cell walls .

  • Morin staining: Another fluorescent dye that can be used to visualize Al in plant tissues, with fluorescence intensity correlating with Al concentration.

  • Inductively Coupled Plasma Mass Spectrometry (ICP-MS): This highly sensitive analytical technique provides precise quantitative measurements of Al concentrations in different plant tissues or cellular compartments. In studies of NIP1;2, ICP-MS was used to measure Al concentrations in the root cell wall and root cell sap separately, revealing significantly higher Al concentrations in the cell wall and lower concentrations in the symplasm of nip1;2 mutants compared to wild-type plants .

  • Cellular fractionation: To distinguish between apoplastic and symplastic Al pools, researchers can separate the root cell wall and cell sap fractions prior to analysis. This approach was crucial in demonstrating NIP1;2's role in facilitating Al movement from the cell wall to the symplasm .

  • X-ray microanalysis and electron microscopy: These techniques can provide detailed information about Al localization at the subcellular level, though they were not specifically mentioned in the search results for NIP1;2 studies.

The combination of these methods provides complementary qualitative and quantitative data on Al distribution patterns, enabling researchers to comprehensively characterize the effects of genetic modifications or treatments on Al accumulation and translocation.

How can researchers generate and characterize recombinant NIP1;2 for functional studies?

Generation and characterization of recombinant NIP1;2 for functional studies involves several key approaches:

  • Expression vector construction:

    • Clone the full-length NIP1;2 coding sequence into appropriate expression vectors for different host systems

    • Add epitope tags (His, FLAG, etc.) for detection and purification

    • Consider including fluorescent protein fusions for localization studies

  • Expression systems:

    • Yeast: Saccharomyces cerevisiae has been successfully used to express NIP1;2 and study its Al-malate transport capability

    • Xenopus oocytes: A common system for aquaporin functional studies

    • Plant cell cultures: Provide a more native environment for protein folding and post-translational modifications

    • E. coli: May be used for large-scale protein production, though membrane proteins often face folding challenges

  • Purification strategies:

    • Detergent solubilization of membrane fractions

    • Affinity chromatography using tagged recombinant proteins

    • Size exclusion chromatography for final purification

  • Functional characterization:

    • Transport assays: Measure Al uptake in cells or vesicles expressing NIP1;2

    • Electrophysiology: Characterize channel properties in systems like Xenopus oocytes

    • Substrate specificity tests: Examine transport of Al-malate versus free Al³⁺ and other potential substrates

    • Proteoliposome reconstitution: Study transport activity in a defined membrane environment

  • Structural analysis:

    • Circular dichroism: Assess secondary structure composition

    • Crystallization attempts: For high-resolution structural information

    • Molecular modeling: Predict structure-function relationships

These approaches, particularly heterologous expression in yeast followed by transport assays, have been instrumental in demonstrating that NIP1;2 facilitates the transport of Al-malate but not free Al³⁺ ions .

What molecular genetics approaches are most effective for studying NIP1;2 function in planta?

Several molecular genetics approaches have proven effective for studying NIP1;2 function in plants:

  • T-DNA insertion lines: Studies have utilized multiple independent T-DNA insertion lines in NIP1;2, including nip1;2-1 (SALK_126593), nip1;2-2 (SALK_147353), and nip1;2-3 (SALK_076128), with insertions in the exon, intron, and promoter regions, respectively. These lines provide valuable loss-of-function models for phenotypic analysis .

  • Gene expression analysis:

    • qRT-PCR: Real-time quantitative RT-PCR has been used to confirm the loss of NIP1;2 expression in mutant lines and to examine expression patterns in response to Al stress .

    • Promoter-reporter constructs: These can be used to visualize tissue-specific expression patterns and responses to different stresses.

  • Complementation studies: Reintroducing functional NIP1;2 into mutant lines to confirm that the observed phenotypes are specifically due to the loss of NIP1;2 function.

  • Overexpression studies: Generating transgenic lines that overexpress NIP1;2 to assess whether enhanced expression can improve Al tolerance.

  • Site-directed mutagenesis: Creating variants with specific amino acid substitutions to identify residues critical for transport function or regulation.

  • Double mutant analysis: Generating and analyzing double mutants (e.g., nip1;2 almt1) to understand genetic interactions between different components of the Al tolerance system. This approach has been particularly valuable in demonstrating the functional dependency between NIP1;2 and ALMT1 .

  • CRISPR/Cas9 genome editing: Creating precise modifications to NIP1;2 or regulatory elements to study structure-function relationships without the positional effects that can occur with T-DNA insertions.

These molecular genetics approaches, particularly when combined with the physiological and biochemical analyses described earlier, provide powerful tools for dissecting NIP1;2 function in the context of the whole plant.

What experimental designs are most suitable for assessing NIP1;2's role in aluminum tolerance?

Effective experimental designs for assessing NIP1;2's role in aluminum tolerance should incorporate multiple approaches to capture both physiological responses and molecular mechanisms:

  • Dose-response studies:

    • Expose wild-type and nip1;2 mutant plants to a range of Al concentrations (e.g., 0-50 μM) at acidic pH (typically pH 4.2)

    • Measure root growth inhibition as a primary indicator of Al sensitivity

    • Plot dose-response curves to quantify differences in Al sensitivity

  • Time-course analysis:

    • Monitor short-term (0-8 h) and long-term (days) responses to Al exposure

    • Examine changes in gene expression, protein localization, and Al distribution over time

    • This approach has revealed important temporal aspects of Al uptake and distribution in nip1;2 mutants

  • Cellular compartmentation studies:

    • Separate and analyze Al content in different cellular compartments (cell wall vs. symplasm)

    • Compare patterns between wild-type and mutant plants

    • This approach was crucial in demonstrating NIP1;2's role in facilitating Al movement from the cell wall to the symplasm

  • Root-to-shoot translocation experiments:

    • Measure Al content in roots and shoots separately after Al exposure

    • Calculate translocation factors (shoot Al/root Al) to quantify differences in Al mobility

    • This can reveal NIP1;2's role in systemic Al distribution

  • Metal specificity tests:

    • Compare responses to Al with other metal ions (Cd²⁺, La³⁺, Zn²⁺, Cu²⁺)

    • This approach has confirmed that nip1;2 mutants are specifically sensitive to Al rather than showing general metal sensitivity

  • Combined genetic studies:

    • Analyze double mutants affecting both external exclusion (e.g., almt1) and internal tolerance (nip1;2) mechanisms

    • This can reveal synergistic or additive effects and functional dependencies between different Al tolerance components

Comparative Aluminum Sensitivity in Arabidopsis Genotypes

GenotypeRelative Root Growth (%) at 25 μM AlAl Accumulation in Root Cell WallAl Content in Root SymplasmRoot-to-Shoot Al Translocation
Wild-type (Col-0)100% (reference)StandardStandardStandard
nip1;2-1~60%Significantly higherSignificantly lowerReduced
nip1;2-2~65%Significantly higherSignificantly lowerReduced
nip1;2-3~70%HigherLowerReduced
almt1~40%HigherLowerSeverely reduced

This table synthesizes findings from multiple experiments reported in the research literature . Note that exact values may vary between specific experimental conditions.

NIP1;2 Expression Response to Different Metal Stresses

Metal StressNIP1;2 Expression Fold ChangeDuration for Maximal Induction
Al³⁺ (50 μM)Significant increaseSeveral hours
Cd²⁺No significant changeN/A
La³⁺No significant changeN/A
Zn²⁺No significant changeN/A
Cu²⁺No significant changeN/A

This table illustrates the metal-specific nature of NIP1;2 induction, highlighting that its expression is enhanced specifically by Al stress but not by other toxic metal ions .

Key Experimental Techniques for Studying NIP1;2 Function

TechniqueApplicationKey Findings for NIP1;2
Hematoxylin stainingVisualization of Al accumulation in rootsStronger staining in nip1;2 mutant root tips
ICP-MS analysisQuantitative measurement of Al contentHigher Al in cell wall, lower in symplasm of nip1;2 mutants
qRT-PCRGene expression analysisNIP1;2 expression in roots is enhanced by Al but not other metals
Heterologous expressionFunctional characterizationNIP1;2 transports Al-malate but not free Al³⁺ in yeast
T-DNA insertion linesGenetic analysisThree independent lines showed Al hypersensitivity
Root growth assaysPhenotypic characterizationnip1;2 mutants show reduced root growth under Al stress

This table summarizes the key experimental approaches that have been used to characterize NIP1;2 function and their principal findings .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.