Recombinant Arabidopsis thaliana Aquaporin TIP1-2 (TIP1-2)

Shipped with Ice Packs
In Stock

Description

Production and Biochemical Characteristics

Recombinant TIP1-2 is synthesized in heterologous systems, including E. coli, yeast, baculovirus, and mammalian cells, with purity typically exceeding 85% as determined by SDS-PAGE . Key production parameters include:

ParameterDetails
Host SystemsE. coli, yeast, baculovirus, mammalian cells, or cell-free expression
Purity≥85% (SDS-PAGE validated)
StorageLiquid form: 6 months at -20°C/-80°C; Lyophilized: 12 months
TagN-terminal 10xHis-tag for purification
Sequence LengthFull-length (253 amino acids)

The protein’s sequence (UniProt: Q41963) includes conserved aquaporin motifs, such as the NPA domains critical for channel gating .

Water and Solute Transport

TIP1-2 facilitates water transport across tonoplast membranes, contributing to cellular osmoregulation . Unlike plasma membrane aquaporins (e.g., PIPs), TIP1-2 primarily localizes to the tonoplast and may participate in:

  • Water uptake under stress: Induced by NaCl or abscisic acid (ABA) .

  • Urea and H₂O₂ transport: Demonstrated in yeast heterologous systems .

Stress Adaptation

TIP1-2 expression is upregulated under salt stress (NaCl) and drought, though its role in water status remains debated . Mutant studies reveal:

  • Double mutants (TIP1;1 + TIP1;2): Minor increases in anthocyanin content and reduced catalase activity but no significant changes in water status .

  • Subcellular relocalization: TIP1;1 (but not TIP1;2) forms intracellular vesicles under salt stress, suggesting distinct trafficking mechanisms .

Gene Expression and Localization

ConditionExpression PatternLocalization
NaCl treatmentTranscript levels increase Tonoplast
ABA treatmentInduced expression Tonoplast
Salt stress (2–4 hours)Reduced PIP/TIP transcript abundance (60–75% decline) Unchanged (TIP1;2-GFP fusion)

Functional Studies

  • Yeast complementation: Expressing TIP1-2 in salt-sensitive yeast restores growth under NaCl stress, indicating osmoprotective roles .

  • Catalase activity: Loss of TIP1;2 in double mutants reduces catalase, suggesting indirect links to redox homeostasis .

Protein Engineering

Recombinant TIP1-2 is used to:

  • Study membrane trafficking: Fluorescent fusions (e.g., GFP) track tonoplast dynamics under stress .

  • Test solute specificity: Yeast assays confirm urea and H₂O₂ transport .

Crop Improvement

While TIP1;2 overexpression in plants is less studied than PIPs, its role in salt tolerance suggests potential for:

  • Drought-resistant crops: Engineering TIP1;2 to enhance water retention under osmotic stress.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
TIP1-2; SITIP; TIP2; At3g26520; MFE16.17; Aquaporin TIP1-2; Gamma-tonoplast intrinsic protein 2; Gamma-TIP2; Salt stress-induced tonoplast intrinsic protein; Tonoplast intrinsic protein 1-2; AtTIP1;2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-253
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
TIP1-2
Target Protein Sequence
MPTRNIAIGGVQEEVYHPNALRAALAEFISTLIFVFAGSGSGIAFNKITDNGATTPSGLVAAALAHAFGLFVAVSVGANISGGHVNPAVTFGVLLGGNITLLRGILYWIAQLLGSVAACFLLSFATGGEPIPAFGLSAGVGSLNALVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLIGGGLAGIIYDFVFIDENAHEQLPTTDY
Uniprot No.

Target Background

Function
This aquaporin is essential for facilitating water transport across cell membranes. It likely plays a role in osmoregulation in plants under high osmotic stress, such as high salt conditions. In yeast cells, it transports urea in a pH-independent manner and also transports H2O2.
Gene References Into Functions
  1. TIP1;1 and TIP1;2 single or double mutants did not exhibit significant changes in water content or water retention. They also did not show signs of early senescence or growth retardation. [TIP1;2] PMID: 18643996
Database Links

KEGG: ath:AT3G26520

STRING: 3702.AT3G26520.1

UniGene: At.23902

Protein Families
MIP/aquaporin (TC 1.A.8) family, TIP (TC 1.A.8.10) subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.
Tissue Specificity
Widely expressed. Predominantly expressed in roots.

Q&A

What is the biological context of TIP1-2 within the Arabidopsis aquaporin family?

TIP1-2 belongs to the tonoplast intrinsic protein (TIP) subfamily, one of four major aquaporin subfamilies in Arabidopsis thaliana. The Arabidopsis genome contains 38 sequences with homology to aquaporins, distributed across the PIP, TIP, NIP, and SIP subfamilies . TIPs are primarily localized to the tonoplast (vacuolar membrane) and facilitate the movement of water and other small molecules across this membrane. Within the TIP subfamily classification, TIP1-2 is part of the TIP1 subgroup that includes three members in Arabidopsis.

How does TIP1-2 differ functionally from other TIP subfamily members?

The TIP family exhibits diverse substrate specificities beyond water transport. While all TIPs facilitate water movement across the tonoplast, they differ in their permeability to other molecules. For example, some TIPs transport ammonia, urea, H₂O₂, and glycerol . TIP1-2, as part of the TIP1 subgroup, likely shares functional characteristics with other TIP1 proteins, though its specific substrate profile must be experimentally determined through permeability assays in heterologous expression systems.

TIP SubfamilyKnown SubstratesLocalizationRepresentative Roles
TIP1Water, H₂O₂, glycerolTonoplastCell growth, oxidative stress response
TIP2Water, ammonia, ureaTonoplastNitrogen metabolism, osmotic regulation
TIP3Water, various solutesTonoplastSeed development, germination
TIP4WaterTonoplastSpecialized vacuolar functions
TIP5WaterTonoplastSpecialized vacuolar functions

Note: This table represents general patterns across the TIP subfamilies based on available research; specific TIP1-2 properties require experimental verification.

What experimental approaches are suitable for basic characterization of TIP1-2?

For initial characterization of TIP1-2:

  • Sequence analysis: Perform phylogenetic analysis to establish evolutionary relationships with other plant aquaporins.

  • Expression profiling: Use RT-PCR or RNA-seq to determine tissue-specific and developmental expression patterns.

  • Subcellular localization: Generate TIP1-2-GFP fusion constructs under native promoters to confirm tonoplast localization through confocal microscopy.

  • Antibody generation: Develop specific antibodies against unique epitopes of TIP1-2 for immunolocalization and western blot analysis.

What expression systems are most effective for producing functional recombinant TIP1-2?

Heterologous expression of plant membrane proteins presents several challenges. For recombinant TIP1-2 production, consider these systems with their respective advantages:

  • Yeast expression systems (Saccharomyces cerevisiae or Pichia pastoris):

    • Advantages: Eukaryotic processing, high yield, ease of scale-up

    • Methodology: Clone TIP1-2 coding sequence into a yeast expression vector with an appropriate promoter (e.g., GAL1) and a purification tag (His or FLAG)

  • Xenopus oocyte expression:

    • Advantages: Ideal for functional studies, native membrane environment

    • Methodology: Inject in vitro transcribed TIP1-2 cRNA into oocytes and measure water/solute permeability using swelling assays

  • Plant-based expression (Nicotiana benthamiana transient expression):

    • Advantages: Plant-specific post-translational modifications, relevant membrane environment

    • Methodology: Agrobacterium-mediated infiltration of TIP1-2 constructs followed by membrane isolation

The experimental design should include appropriate controls and consider the specific research question being addressed .

How can I verify the functionality of recombinant TIP1-2?

Validation of recombinant TIP1-2 functionality requires multiple approaches:

  • Water permeability assays:

    • Stopped-flow spectrophotometry with proteoliposomes containing purified TIP1-2

    • Swelling assays in Xenopus oocytes expressing TIP1-2

    • Measurement of osmotic water permeability coefficient (Pf)

  • Substrate specificity analysis:

    • Radioactive or fluorescent substrate uptake assays

    • pH-sensitive dyes for detection of ammonia transport

    • H₂O₂ transport using ROS-sensitive fluorescent probes

  • Inhibitor sensitivity:

    • Test mercury-sensitivity (characteristic of many aquaporins)

    • Evaluate effects of other known aquaporin inhibitors

These methods should be designed with appropriate controls, including non-functional TIP1-2 mutants and other characterized aquaporins .

How is TIP1-2 expression regulated in response to environmental conditions?

While specific information about TIP1-2 regulation is limited, studies on other TIP family members provide valuable insights. For instance, TIP2;2 expression increases during dark adaptation and decreases under far-red light illumination, with phytochrome A (phyA) playing a role in this regulation . To investigate TIP1-2 regulation:

  • Light/dark conditions: Expose plants to various light regimes and monitor TIP1-2 expression through qRT-PCR or western blotting.

  • Abiotic stress responses: Subject plants to drought, salt, cold, or heat stress and evaluate changes in TIP1-2 transcript and protein levels.

  • Phytohormone treatments: Apply different plant hormones (ABA, auxin, ethylene) and assess their impact on TIP1-2 expression.

  • Promoter analysis: Identify potential regulatory elements in the TIP1-2 promoter associated with environmental responses.

What molecular mechanisms control TIP1-2 trafficking and membrane insertion?

Membrane protein trafficking involves multiple post-translational modifications and protein-protein interactions. For TIP1-2:

  • Post-translational modifications:

    • S-acylation (palmitoylation) may regulate membrane affinity, as seen with other membrane proteins in Arabidopsis

    • Phosphorylation sites can regulate trafficking and channel activity

  • Trafficking mechanisms:

    • Vesicular trafficking components involved in tonoplast protein delivery

    • ER-to-Golgi-to-vacuole transport pathways

    • Direct ER-to-vacuole trafficking routes

  • Experimental approaches:

    • Brefeldin A treatment to disrupt Golgi-dependent trafficking

    • Co-immunoprecipitation to identify interacting trafficking partners

    • Live-cell imaging of fluorescently-tagged TIP1-2 to track movement

What methodologies are suitable for assessing TIP1-2 function in planta?

To determine the physiological roles of TIP1-2 in plants:

  • Genetic approaches:

    • Generate and characterize tip1-2 knockout mutants

    • Create TIP1-2 overexpression lines

    • Develop complementation lines expressing TIP1-2 variants

  • Physiological measurements:

    • Water relations parameters (hydraulic conductivity, osmotic potential)

    • Drought and salt stress tolerance assays

    • Nitrogen utilization efficiency (if TIP1-2 transports nitrogenous compounds)

  • Cell biology techniques:

    • Vacuolar morphology and dynamics assessment

    • Vacuolar pH and ion content analysis

    • Metabolite profiling in mutant vs. wild-type plants

How does TIP1-2 contribute to plant development and stress responses?

While specific information about TIP1-2's developmental role is limited, studies on related proteins suggest potential functions:

  • Developmental processes:

    • Cell expansion and growth regulation

    • Seed germination and seedling establishment

    • Root system architecture development

  • Stress response mechanisms:

    • Osmotic stress adaptation through vacuolar water flux regulation

    • Potential roles in reactive oxygen species (ROS) homeostasis if permeable to H₂O₂

    • Nitrogen metabolism and recycling if permeable to ammonia or urea

To investigate these aspects, researchers should employ a combination of physiological, molecular, and cell biological approaches with appropriate experimental designs .

How can structure-function analysis of TIP1-2 inform aquaporin engineering?

Advanced structural studies of TIP1-2 can provide insights for rational protein design:

  • Structure determination approaches:

    • X-ray crystallography of purified recombinant TIP1-2

    • Cryo-electron microscopy to visualize TIP1-2 in membrane environments

    • Molecular dynamics simulations to predict substrate interactions

  • Structure-guided mutagenesis:

    • Target conserved NPA motifs and pore-lining residues

    • Modify selectivity filter residues to alter substrate specificity

    • Engineer pH sensitivity or regulatory domains

  • Applications of engineered TIP1-2 variants:

    • Enhanced drought tolerance in transgenic plants

    • Improved nutrient use efficiency

    • Biomonitoring systems for detecting specific molecules

What emerging technologies can advance TIP1-2 research?

Several cutting-edge approaches offer new possibilities for TIP1-2 investigation:

  • CRISPR/Cas9 genome editing:

    • Generate precise mutations in TIP1-2 coding or regulatory regions

    • Create reporter knock-ins at the native TIP1-2 locus

    • Develop tissue-specific or inducible TIP1-2 knockout systems

  • Advanced imaging techniques:

    • Super-resolution microscopy for nanoscale localization

    • Single-molecule tracking to analyze TIP1-2 dynamics in living cells

    • Correlative light and electron microscopy for structure-function studies

  • Systems biology approaches:

    • Proteomics to identify TIP1-2 interactome

    • Metabolomics to assess the impact of TIP1-2 manipulation on cellular metabolites

    • Transcriptomics to understand global responses to TIP1-2 modulation

These advanced approaches should be integrated with traditional techniques to develop a comprehensive understanding of TIP1-2 function in plant biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.