Recombinant Arabidopsis thaliana Aquaporin TIP1-3 (TIP1-3)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Plant Physiology

TIP1-3 belongs to the tonoplast intrinsic protein (TIP) subfamily, which facilitates water and small solute transport across vacuolar membranes. Key functional insights include:

  • Water and Urea Transport: TIP1-3 functions as a selective channel for water and urea in pollen, critical for maintaining cellular hydration during reproduction .

  • Stress Response: While not directly tested in salinity studies, TIP homologs (e.g., TIP1;1, TIP1;2) show rapid downregulation under salt stress, suggesting a conserved role in osmotic adjustment .

  • Viral Interaction: TIP1-3 interacts with cucumber mosaic virus (CMV) Protein 1a, potentially influencing viral replication or movement .

Expression and Localization

  • Tissue Specificity: TIP1-3 is predominantly expressed in pollen, with minimal detection in roots or vegetative tissues .

  • Subcellular Dynamics: Under stress, TIP homologs undergo relocalization. For example, salt exposure induces TIP1;1 redistribution into intravacuolar structures , though TIP1-3-specific behavior remains uncharacterized.

Transcriptional Regulation

  • Salt Stress: Macroarray data reveal a 60–75% decrease in TIP transcript levels within 2–4 hours of salt exposure . While TIP1-3 was not explicitly measured, this highlights broader aquaporin regulatory mechanisms.

Technical Applications

Recombinant TIP1-3 is utilized in:

  • Biophysical Studies: Investigating water permeability and solute selectivity using planar lipid bilayers or Xenopus oocyte assays.

  • Antibody Production: Serving as an antigen for isoform-specific antibodies .

  • Structural Biology: Crystallization trials to resolve pore architecture and gating mechanisms .

Future Directions

  • Characterize TIP1-3’s role in pollen hydration and stress resilience using knockout mutants.

  • Explore its interaction with CMV Protein 1a to elucidate viral pathogenesis mechanisms .

  • Develop fluorescence-based assays to monitor real-time subcellular trafficking under abiotic stress.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, it is recommended to briefly centrifuge the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
TIP1-3; At4g01470; F11O4.1; Aquaporin TIP1-3; Gamma-tonoplast intrinsic protein 3; Gamma-TIP3; Tonoplast intrinsic protein 1-3; AtTIP1;3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
TIP1-3
Target Protein Sequence
MPINRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPAGLVAASLSHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLLLKVSTGGMETAAFSLSYGVTPWNAVVFEIVMTFGLVYTVYATAVDPKKGDIGIIAPLAIGLIVGANILVGGAFDGASMNPAVSFGPAVVSWIWTNHWVYWVGPFIGAAIAAIVYDTIFIGSNGHEPLPSNDF
Uniprot No.

Target Background

Function
TIP1-3 is a potential aquaporin, which may facilitate the transport of water and small neutral solutes across cell membranes.
Database Links

KEGG: ath:AT4G01470

STRING: 3702.AT4G01470.1

UniGene: At.65315

Protein Families
MIP/aquaporin (TC 1.A.8) family, TIP (TC 1.A.8.10) subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.

Q&A

What is Arabidopsis thaliana Aquaporin TIP1-3?

Arabidopsis thaliana Aquaporin TIP1-3 is a member of the tonoplast intrinsic protein (TIP) family of aquaporins found in the model plant Arabidopsis thaliana. Like other aquaporins, TIP1-3 functions as a membrane channel protein that facilitates the transport of water and small neutral solutes across cellular membranes. TIP1-3 belongs to the TIP1 subfamily, which includes other members like TIP1;1 and TIP1;2. While TIP proteins are traditionally associated with the vacuolar membrane (tonoplast), research indicates that members of the TIP family, including those related to TIP1-3, can also be found in chloroplast membranes, suggesting a more complex subcellular distribution and functional role than previously recognized .

How does TIP1-3 differ from other TIP family aquaporins?

TIP1-3 shares structural similarities with other TIP1 subfamily members (TIP1;1 and TIP1;2) but exhibits unique expression patterns and potentially specialized functions. While comprehensive studies specific to TIP1-3 are still emerging, research on the TIP family indicates that different TIP isoforms can exhibit differential localization within cellular compartments. For example, TIP1;1 has been found in the chloroplast envelope, TIP2;1 in thylakoid membranes, and TIP1;2 in both envelope and thylakoid membranes . These localization differences suggest specialized roles for different TIP family members in water transport across specific subcellular compartments, with implications for their physiological functions in processes such as osmoregulation and photosynthesis.

What methodologies are most effective for studying TIP1-3 localization in plant cells?

For studying TIP1-3 localization, a multi-faceted approach combining fluorescence microscopy, subcellular fractionation, and immunodetection techniques provides the most comprehensive results. Based on research methodologies used for other TIP family members, the following protocol is recommended:

  • Fluorescence microscopy with GFP fusion proteins: Generate transgenic Arabidopsis plants expressing TIP1-3-GFP fusion proteins under native or constitutive promoters. Analyze the subcellular localization using confocal laser scanning microscopy, with chlorophyll autofluorescence as a chloroplast marker.

  • Immunogold electron microscopy: Use specific antibodies against TIP1-3 followed by gold-conjugated secondary antibodies to precisely locate the protein at the ultrastructural level, which can reveal membrane-specific localization.

  • Subcellular fractionation and Western blotting: Isolate different membrane fractions (tonoplast, chloroplast envelope, thylakoid membranes) through differential centrifugation, followed by immunoblotting with TIP1-3-specific antibodies.

  • Co-localization studies: Employ dual-labeling experiments using known organelle markers alongside TIP1-3-specific labeling to confirm subcellular localization.

Similar approaches applied to other TIP family members have revealed their unexpected presence in chloroplast membranes in addition to the tonoplast . For instance, TIP1;1 was localized to the chloroplast envelope, while TIP2;1 was found in thylakoid membranes using these techniques.

How does TIP1-3 contribute to chloroplast function and photosynthesis?

TIP1-3, like other TIP family aquaporins found in chloroplasts, likely plays a crucial role in chloroplast osmoregulation and photosynthetic efficiency. Research on related TIP family members provides insights into potential TIP1-3 functions:

While these functions have been demonstrated for TIP1;1, TIP1;2, and TIP2;1, similar roles may be anticipated for TIP1-3 given its structural relatedness within the TIP family.

What experimental approaches should be used to characterize TIP1-3 function under osmotic stress conditions?

To characterize TIP1-3 function under osmotic stress conditions, the following experimental approaches are recommended:

  • Osmotic challenge assays with isolated chloroplasts:

    • Isolate intact chloroplasts from wild-type and tip1-3 mutant plants

    • Subject them to varying osmotic potentials using sorbitol or mannitol solutions

    • Measure volume changes using light scattering techniques

    • Compare osmotic water permeability (Pf) between wild-type and mutant chloroplasts

  • Thylakoid volume dynamics assessment:

    • Isolate thylakoid membranes from wild-type and tip1-3 mutant plants

    • Monitor light-induced volume changes using stopped-flow spectrophotometry

    • Analyze the kinetics of shrinkage and swelling under different osmotic conditions

  • Chloroplast functionality tests:

    • Measure photosynthetic parameters (oxygen evolution, electron transport rates, NPQ)

    • Employ pulse-amplitude modulation (PAM) fluorometry to assess PSII quantum yield

    • Analyze these parameters under normal and osmotic stress conditions

  • Complementation studies:

    • Generate transgenic tip1-3 mutant lines expressing TIP1-3-GFP fusion protein

    • Assess restoration of wild-type phenotypes regarding osmotic response

    • Quantify chloroplast and thylakoid volume regulation capacity

This approach parallels successful experiments with other TIP family members, where mutants lacking TIP1;2 and/or TIP2;1 showed significant impairment in chloroplast volume regulation capability compared to wild-type plants, with thylakoids undergoing less volume changes upon osmotic treatment and in response to light .

How do TIP1-3 aquaporins interact with photosynthetic complexes in thylakoid membranes?

The interaction between TIP1-3 and photosynthetic complexes likely involves both structural proximity and functional coordination. Based on research with related TIP aquaporins, the following interaction mechanisms can be proposed:

  • Physical proximity to photosystems: Aquaporins in thylakoid membranes may be positioned near photosystem II complexes to facilitate water supply for the water-splitting process. This strategic positioning would optimize water delivery to the oxygen-evolving complex.

  • Role in proton gradient formation: TIP aquaporins likely influence the formation and maintenance of the proton gradient across thylakoid membranes. Research on tip mutants showed reduced lumen acidification, suggesting a relationship between water channels and proton accumulation in the lumen .

  • Coordination with NPQ mechanisms: TIP1-3 may functionally interact with components of non-photochemical quenching (NPQ) mechanisms. Studies with tip2;1 mutants revealed slower NPQ induction during transitions from low to high light, indicating a role in the rapid response to fluctuating light conditions .

  • Potential protein-protein interactions: TIP aquaporins may form complexes with photosynthetic proteins or regulatory factors, although direct evidence of such interactions remains to be fully established.

To study these interactions, techniques such as Blue Native-PAGE, co-immunoprecipitation, split-GFP assays, and FRET analysis would be valuable to identify potential protein interaction partners of TIP1-3 among photosynthetic complexes.

What protocols are recommended for functional characterization of recombinant TIP1-3?

For comprehensive functional characterization of recombinant TIP1-3, the following experimental protocols are recommended:

  • Heterologous expression systems:

    • Express recombinant TIP1-3 in Xenopus laevis oocytes for water permeability assays

    • Use yeast expression systems for complementation studies in osmo-sensitive yeast mutants

    • Express in insect cells (Sf9) for large-scale protein production and purification

  • Water transport activity measurement:

    • In oocytes: Measure water permeability coefficient (Pf) using hypotonic challenge and video microscopy

    • In proteoliposomes: Reconstitute purified TIP1-3 in liposomes and measure water transport using stopped-flow light scattering

    • Parameter analysis: Determine activation energy (Ea) and pH sensitivity of water transport

  • Substrate specificity determination:

    • Test permeability to small neutral solutes (glycerol, urea, hydrogen peroxide)

    • Compare transport rates with other TIP family members using radioactive tracers

    • Analyze the effects of mercury and other aquaporin inhibitors on transport activity

  • Structural characterization:

    • Perform circular dichroism (CD) spectroscopy to assess secondary structure

    • Conduct single-particle cryo-electron microscopy to determine protein structure

    • Use molecular dynamics simulations to predict water conduction pathway

These approaches have been successfully applied to characterize other plant aquaporins and would provide valuable insights into the functional properties of TIP1-3, particularly in comparison to the better-studied TIP1;1, TIP1;2, and TIP2;1 proteins .

What considerations are important when designing TIP1-3 knockout or overexpression studies?

When designing TIP1-3 knockout or overexpression studies, several critical considerations must be addressed:

  • Genetic redundancy assessment:

    • Generate single tip1-3 mutants as well as multiple mutants with other TIP family members

    • Create tip1-3/tip1;1, tip1-3/tip1;2, and tip1-3/tip2;1 double mutants to assess functional overlap

    • Consider triple or quadruple mutants if phenotypes are subtle due to redundancy

  • Promoter selection for overexpression:

    • Native promoter: Use the TIP1-3 native promoter for physiologically relevant expression

    • Constitutive promoter (35S): For strong expression to maximize phenotypic effects

    • Inducible promoter systems: To control expression timing for temporal studies

    • Tissue-specific promoters: To target expression to specific tissues of interest

  • Reporter tag considerations:

    • Position of tag (N- vs C-terminal) may affect protein targeting and function

    • Select appropriate tags (GFP, mCherry, FLAG) based on experimental objectives

    • Include untagged controls to verify that tag doesn't interfere with function

  • Physiological characterization approach:

    • Design experiments under multiple environmental conditions (standard, drought, high light)

    • Include detailed photosynthetic parameter measurements (ETR, NPQ, ΔpH)

    • Measure chloroplast and thylakoid volume changes under osmotic challenges

    • Monitor responses to fluctuating light conditions, which may reveal phenotypes not evident under constant light

Research with other TIP family members has shown that single mutants often display subtle or no visible phenotypes under standard growth conditions, highlighting the importance of multiple-mutant approaches and stress conditions to reveal functional roles .

What techniques are most reliable for measuring TIP1-3-mediated water transport in chloroplasts?

For reliable measurement of TIP1-3-mediated water transport in chloroplasts, the following techniques are recommended:

  • Stopped-flow spectroscopy with isolated chloroplasts:

    • Rapidly mix isolated chloroplasts with solutions of different osmolarity

    • Monitor the kinetics of volume change via light scattering at 90° angle

    • Calculate water permeability coefficient (Pf) from the rate of volume change

    • Compare wild-type versus tip1-3 mutant chloroplasts to quantify TIP1-3 contribution

  • Chloroplast swelling/shrinking assays:

    • Subject intact chloroplasts to varying osmotic conditions

    • Monitor volume changes using confocal microscopy with time-lapse imaging

    • Quantify volume changes using image analysis software

    • Data analysis should include rate constants for water movement

  • Thylakoid lumen pH measurements:

    • Use pH-sensitive fluorescent proteins targeted to the thylakoid lumen

    • Monitor pH changes in response to light and varying osmotic conditions

    • Compare wild-type and tip1-3 mutant responses to assess water transport effects on proton movement

  • Pressure probe techniques for in vivo measurements:

    • Apply cell pressure probe techniques to measure hydraulic conductivity

    • Adapt techniques for chloroplast measurements using micromanipulation

    • Determine hydraulic parameters in intact cells versus isolated organelles

Based on research with other TIP aquaporins, these methods have successfully demonstrated reduced osmotic water permeability in chloroplasts and thylakoids from tip1;2 and tip2;1 mutants compared to wild-type plants, highlighting their contribution to water transport across chloroplast membranes .

How should researchers interpret conflicting data on TIP1-3 localization from different experimental approaches?

When faced with conflicting data on TIP1-3 localization from different experimental approaches, researchers should:

  • Critically assess methodology limitations:

    • Antibody specificity: Cross-reactivity with other TIP family members may lead to false positives

    • Overexpression artifacts: High expression levels with foreign promoters may cause mistargeting

    • Fractionation purity: Contamination between membrane fractions may confound results

    • Fusion protein effects: Tags may interfere with normal targeting signals

  • Implement a consensus approach:

    • Triangulate findings using multiple independent techniques (microscopy, fractionation, immunodetection)

    • Use both N- and C-terminal tags to rule out tag position effects

    • Confirm antibody specificity using appropriate knockout controls

    • Combine in vivo imaging with biochemical approaches

  • Consider physiological conditions:

    • Localization may be dynamic and condition-dependent

    • Test multiple developmental stages and environmental conditions

    • Assess localization under stress conditions relevant to aquaporin function

  • Quantitative assessment:

    • Determine relative distribution across different membranes

    • Use quantitative proteomics to measure abundance in different fractions

    • Report confidence intervals for localization claims

Research on TIP1;1, TIP1;2, and TIP2;1 initially yielded contradictory results regarding their chloroplast localization, but a combination of GFP fluorescence microscopy and western blotting with fractionated membranes ultimately confirmed their presence in chloroplast membranes, with TIP2;1 in thylakoids, TIP1;1 in the envelope, and TIP1;2 in both locations .

What are the implications of TIP1-3 function for engineering drought-resistant crops?

Understanding TIP1-3 function offers several potential avenues for engineering drought-resistant crops:

  • Enhanced osmotic adjustment capacity:

    • Targeted overexpression of TIP1-3 in chloroplasts may improve osmotic adjustment during drought

    • This could maintain photosynthetic functionality under water limitation

    • Improved water transport efficiency across chloroplast membranes may sustain energy production during drought

  • Optimized photosynthetic performance under stress:

    • TIP aquaporins in chloroplasts contribute to maintaining photosynthetic electron transport

    • Engineering TIP1-3 expression may help preserve photosynthetic capacity under water deficit

    • This could reduce yield losses associated with drought-induced photosynthetic inhibition

  • Enhanced photoprotection mechanisms:

    • TIP aquaporins influence non-photochemical quenching (NPQ) induction kinetics

    • Modulating TIP1-3 could optimize photoprotection during drought-induced light stress

    • This may prevent photodamage when stomatal closure limits CO2 availability

  • Potential transgenic approaches:

    • Constitutive overexpression of TIP1-3 with chloroplast targeting signals

    • Expression under drought-inducible promoters for stress-specific activation

    • Creation of modified TIP1-3 variants with enhanced water transport capacity

    • Tissue-specific expression targeted to photosynthetically active tissues

Research on other TIP family members has demonstrated that their presence in chloroplast membranes significantly impacts osmoregulation and photosynthesis . Given the likely functional similarities, TIP1-3 manipulation represents a promising target for maintaining photosynthetic function during drought stress.

How does TIP1-3 function compare with other aquaporin families in plants?

TIP1-3 function has distinct characteristics when compared to other plant aquaporin families:

Aquaporin FamilyPrimary Subcellular LocalizationMain SubstratesPhysiological RolesStress Response
TIP (TIP1-3 and others)Tonoplast, Chloroplast membranesWater, small neutral solutes, H2O2Vacuolar and chloroplast osmoregulation, PhotosynthesisUpregulated during drought and salinity
PIP (Plasma membrane Intrinsic Proteins)Plasma membraneWater, CO2Root water uptake, Leaf transpiration, Stomatal regulationOften downregulated during drought
NIP (NOD26-like Intrinsic Proteins)Plasma membrane, ER, Peribacteroid membraneWater, glycerol, metalloids, ammoniaSymbiotic interactions, Nutrient transport, Boron homeostasisVariable responses to stress
SIP (Small basic Intrinsic Proteins)ER membraneWaterER homeostasisLimited stress response data
XIP (X Intrinsic Proteins)Plasma membraneWater, glycerol, ureaSolute transportPresent in some plants, absent in others

Key functional distinctions of TIP1-3 and related TIP aquaporins:

  • Dual membrane targeting: Unlike most aquaporins that localize to a single membrane system, TIP family members including TIP1-3 can target both tonoplast and chloroplast membranes, suggesting multifunctional roles .

  • Photosynthesis involvement: TIP aquaporins in chloroplasts directly contribute to photosynthetic function through water supply to the thylakoid lumen and osmoregulation during light-dark transitions, a role not observed with other aquaporin families .

  • Substrate profile: While all aquaporins transport water, TIP family members often show broader substrate specificity, including ammonia and hydrogen peroxide transport, which may have important signaling implications.

  • Functional redundancy: Research with tip1;1, tip1;2, and tip2;1 mutants suggests functional redundancy among TIP family members, as single mutants often show subtle phenotypes while double mutants display more pronounced effects on chloroplast function .

What are the future research directions for understanding TIP1-3 function in plant physiology?

Future research on TIP1-3 should address several key knowledge gaps:

  • Structural biology approaches:

    • Determine high-resolution structure of TIP1-3 using cryo-EM or X-ray crystallography

    • Identify structural features responsible for subcellular targeting to multiple membranes

    • Elucidate the molecular basis of substrate selectivity and transport regulation

  • Environmental response dynamics:

    • Characterize TIP1-3 expression and activity changes under climate-relevant stresses

    • Investigate the role of TIP1-3 in plant responses to combined stresses (drought + heat)

    • Examine circadian regulation of TIP1-3 expression and function

  • Interaction networks:

    • Identify protein-protein interactions between TIP1-3 and photosynthetic complexes

    • Characterize potential interactions with regulatory proteins and signaling pathways

    • Determine if TIP1-3 forms heterotetramers with other aquaporins in specific membranes

  • Evolutionary biology perspectives:

    • Compare TIP1-3 function across diverse plant species with varying photosynthetic adaptations

    • Investigate evolutionary history of chloroplast targeting in the TIP family

    • Explore TIP1-3 homologs in C4 and CAM plants with specialized photosynthetic mechanisms

  • Applied research opportunities:

    • Test biotechnological applications of TIP1-3 in improving crop photosynthetic efficiency

    • Develop TIP1-3 variants with enhanced function through protein engineering

    • Explore genetic diversity in TIP1-3 across crop germplasm for breeding applications

This research agenda builds upon current understanding of TIP family aquaporins in chloroplast function, where TIP1;1, TIP1;2, and TIP2;1 have been shown to contribute significantly to osmoregulation and photosynthesis , suggesting similar important roles for TIP1-3 that warrant detailed investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.