Recombinant Arabidopsis thaliana Aquaporin TIP2-3 (TIP2-3)

Shipped with Ice Packs
In Stock

Description

Experimental Uses

  • SDS-PAGE: Used to verify protein purity and confirm successful expression .

  • Structural Studies: ModBase 3D structure models (Q9FGL2) enable analysis of transmembrane topology .

  • Heterologous Systems: Compatible with cell-free expression systems for functional assays .

Functional Context in Plant Physiology

While direct studies on TIP2-3 remain limited, its classification within the TIP subfamily suggests roles in:

  • Vacuolar Water Transport: Regulating osmotic balance and solute flux in plant cells .

  • Tissue-Specific Expression: TIPs are often expressed in tissues requiring rapid water adjustments, such as roots or stress-responsive cells .

Divergence from Other TIPs

FeatureTIP2-3 vs. TIP3s (Seed-Specific)
Tissue LocalizationVacuolar membrane (general)
RegulationNot explicitly studied
Substrate SpecificityWater, glycerol, H₂O₂ (inferred)

Research Gaps and Future Directions

  1. Functional Studies: No direct evidence exists for TIP2-3’s role in stress responses or metabolite transport.

  2. Isoform Redundancy: Functional overlap with other TIPs (e.g., TIP1;1/TIP1;2) may mask phenotypic effects in knockout mutants .

  3. Light Regulation: Phytochrome-dependent modulation observed in TIP2;2 (a related TIP) suggests potential photoreceptor-mediated control of TIP2-3 .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. You can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TIP2-3; At5g47450; MNJ7.4; Aquaporin TIP2-3; Tonoplast intrinsic protein 2-3; AtTIP2;3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
TIP2-3
Target Protein Sequence
MVKIEVGSVGDSFSVSSLKAYLSEFIATLLFVFAGVGSAVAFAKLTSDGALDPAGLVAIAIAHAFALFVGVSIAANISGGHLNPAVTLGLAIGGNITLITGFFYWIAQCLGSIVACLLLVFVTNGKSVPTHGVSAGLGAVEGVVMEIVVTFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVSGDLSQIWIYWVGPLVGGALAGLIYGDVFIGSYEAVETREIRV
Uniprot No.

Target Background

Function
This protein facilitates the transport of methylammonium or ammonium in yeast cells, particularly at high medium pH. It might play a role in vacuolar compartmentation and detoxification of ammonium.
Database Links

KEGG: ath:AT5G47450

STRING: 3702.AT5G47450.1

UniGene: At.43789

Protein Families
MIP/aquaporin (TC 1.A.8) family, TIP (TC 1.A.8.10) subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.
Tissue Specificity
Widely expressed.

Q&A

What is Aquaporin TIP2-3 and what are its alternative nomenclatures?

Aquaporin TIP2-3 (also known as TIP2;3, ARABIDOPSIS THALIANA TONOPLAST INTRINSIC PROTEIN 2;3, ATTIP2;3, DELTA-TIP3, DELTA-TONOPLAST INTRINSIC PROTEIN 3, MNJ7.4, or MNJ7_4) is a member of the tonoplast intrinsic protein family in Arabidopsis thaliana . This protein belongs to the larger aquaporin superfamily, which forms channels in biological membranes that facilitate the transport of water and, in some cases, small uncharged solutes. As indicated by its name, TIP2-3 is predominantly localized to the tonoplast, which is the membrane surrounding the vacuole in plant cells .

The TIP2-3 protein is functionally characterized as a channel that likely allows the bidirectional movement of water between the cytoplasm and the vacuolar lumen, playing crucial roles in cellular water homeostasis. Based on studies of related TIP proteins, TIP2-3 may also transport other small molecules such as ammonia, similar to what has been observed for TIP2;1, which demonstrates permeability to both water and ammonia .

How does TIP2-3 relate to other aquaporin family members in Arabidopsis?

Arabidopsis thaliana contains multiple aquaporin subfamilies including plasma membrane intrinsic proteins (PIPs) and tonoplast intrinsic proteins (TIPs). Within the TIP subfamily, there are several groups (TIP1, TIP2, TIP3, TIP4, and TIP5) with TIP2-3 belonging to the TIP2 subgroup. Each subgroup shows distinct expression patterns, subcellular localizations, and potentially different substrate specificities.

TIP3 proteins, including TIP3;1 and TIP3;2, are seed-specific and shown to be involved in seed longevity . They are expressed during seed maturation and localized to the seed protein storage vacuole membrane . In contrast, TIP1 subfamily members (TIP1;1 and TIP1;2) appear to be expressed during seed germination, with protein levels increasing around 48 hours after germination as TIP3 protein levels decrease .

The functional redundancy between different TIPs might explain why single TIP gene loss-of-function mutants often do not show obvious phenotypes. For instance, the tip1;3/tip5;1 double knockout mutant displays an abnormal rate of barren siliques, indicating that these pollen-specific TIPs contribute to plant reproduction .

What are the predicted structural features of TIP2-3?

While the search results don't provide specific structural information about TIP2-3, based on the conserved structure of aquaporins, TIP2-3 likely shares the following structural features:

  • Six transmembrane α-helical domains connected by five loops (A-E)

  • Two half-helices containing the highly conserved NPA (Asparagine-Proline-Alanine) motifs that form part of the water-selective channel

  • An aromatic/arginine (ar/R) selectivity filter that determines pore size and substrate specificity

  • Cytoplasmic N- and C-terminal domains that may be involved in regulation and protein-protein interactions

The selectivity for different substrates is primarily determined by the composition of the ar/R filter and other pore-lining residues. In TIP2;1, a related aquaporin, a double mutation can render it impermeable to ammonia without affecting water permeability, suggesting distinct molecular determinants for different substrates .

What expression systems are most effective for producing recombinant TIP2-3?

Multiple expression systems can be used to produce recombinant Arabidopsis thaliana Aquaporin TIP2-3, each with specific advantages:

  • Cell-Free Expression: This system allows for rapid production of recombinant TIP2-3 with purity greater than or equal to 85% as determined by SDS-PAGE . This approach is particularly advantageous for membrane proteins like TIP2-3 that may be toxic when expressed in cellular systems.

  • Bacterial Expression (E. coli): This system can be used for producing partial TIP2-3 proteins with purity greater than or equal to 85% . When using bacterial expression systems, optimization strategies might include:

    • Using specialized strains designed for membrane protein expression

    • Lowering induction temperature to 16-20°C

    • Employing mild induction conditions with lower IPTG concentrations

  • Yeast Expression: This eukaryotic system provides post-translational modifications and potentially better membrane insertion for TIP2-3 .

  • Baculovirus/Insect Cell Expression: This system offers advantages for complex proteins that require eukaryotic processing .

  • Mammalian Cell Expression: This provides the most sophisticated post-translational modifications, although typically at lower yields .

The choice of expression system should be determined by the specific experimental requirements, including protein yield, purity, post-translational modifications, and downstream applications.

What purification strategies yield the highest purity TIP2-3 protein?

Based on the available information, purification strategies that can yield TIP2-3 with purity greater than or equal to 85% include:

  • Affinity Chromatography: Using tags such as His-tag or GST-tag for selective binding to affinity resins.

  • Size Exclusion Chromatography: For further purification and to assess protein homogeneity.

  • Ion Exchange Chromatography: As an additional purification step to separate proteins based on charge differences.

For membrane proteins like TIP2-3, the purification workflow typically involves:

  • Cell lysis or membrane isolation

  • Membrane solubilization using appropriate detergents

  • Affinity chromatography

  • Optional further purification steps

  • Quality control using SDS-PAGE to verify size and purity

The search results indicate that commercially available recombinant TIP2-3 has purity greater than or equal to 85% as determined by SDS-PAGE , suggesting that these methods can achieve good purity levels for research applications.

How can researchers verify the quality and functionality of purified TIP2-3?

To ensure that purified recombinant TIP2-3 is of high quality and functionally active, researchers should employ multiple quality control methods:

  • Purity Assessment:

    • SDS-PAGE to verify size and purity (≥85% as indicated in commercial preparations)

    • Western blotting with TIP2-3-specific antibodies to confirm identity

    • Mass spectrometry for accurate molecular weight determination

  • Structural Integrity:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Thermal stability assays to determine protein stability

    • Dynamic light scattering to check for aggregation

  • Functional Assays:

    • Reconstitution into liposomes for water transport assays

    • Stopped-flow spectroscopy to measure water permeability

    • Substrate transport assays for ammonia or other potential substrates

  • Biophysical Characterization:

    • Differential scanning calorimetry for thermal stability analysis

    • Microscale thermophoresis for substrate binding studies

For membrane proteins like TIP2-3, maintaining their native conformation during purification is critical, so the choice of detergents and buffer conditions should be carefully optimized.

What experimental approaches can determine TIP2-3 transport specificity?

Determining the substrate specificity of TIP2-3 requires specialized experimental approaches:

  • Water Transport Assays:

    • Stopped-flow spectroscopy using proteoliposomes containing purified TIP2-3

    • Xenopus oocyte swelling assays with TIP2-3 expressed in oocytes

    • Yeast growth complementation using osmosensitive yeast strains

  • Ammonia Transport Assays:

    • Based on the finding that related TIP2;1 transports both water and ammonia , similar assays for TIP2-3 could include:

    • Yeast complementation using ammonia transport-deficient strains

    • pH-sensitive fluorescent indicators to monitor internal pH changes upon ammonia influx

    • Isotope-labeled ammonia uptake measurements

  • Hydrogen Peroxide Transport:

    • Given that TIP3 proteins may be involved in hydrogen peroxide regulation , TIP2-3 could be tested for:

    • H₂O₂-sensitive growth assays in yeast

    • Fluorescent H₂O₂ sensors in heterologous expression systems

  • Other Potential Substrates:

    • Transport assays for other small neutral molecules like glycerol or urea

    • Substrate competition assays to identify transported molecules

The methods for TIP2;1 mentioned in the search results, including molecular dynamics simulations to calculate permeabilities and free energies along the channel axis for different substrates , could also be applied to TIP2-3.

How can researchers measure water transport activity of TIP2-3 in vitro?

Measuring the water transport activity of TIP2-3 in vitro requires specialized techniques:

  • Proteoliposome-Based Assays:

    • Reconstitution of purified TIP2-3 into liposomes

    • Stopped-flow spectroscopy to measure the rate of liposome shrinkage upon osmotic gradient application

    • Light scattering measurements to monitor volume changes

    • Mathematical modeling to calculate water permeability coefficients (Pf)

  • Microfluidic Approaches:

    • Immobilization of proteoliposomes in microfluidic devices

    • Real-time monitoring of volume changes under controlled osmotic gradients

    • High-throughput analysis of water transport rates

  • Analytical Techniques:

    • Calculation of osmotic water permeability (Pf) values

    • Determination of activation energy (Ea) for water transport

    • Assessment of inhibitor effects (mercury, silver, phloretin) on water transport

For comparative analysis, it's important to include:

  • Empty liposomes (negative control)

  • Liposomes with well-characterized aquaporins (positive control)

  • Systematic variation of protein-to-lipid ratios to analyze concentration-dependent effects

Studies on TIP2;1 indicate that molecular dynamics simulations can complement experimental approaches by providing insights into water permeation pathways and energetics . Similar computational approaches could be valuable for TIP2-3.

What mutation strategies can help identify key functional residues in TIP2-3?

Site-directed mutagenesis is a powerful approach to identify key functional residues in TIP2-3:

  • Selectivity Filter Mutations:

    • Targeting the ar/R selectivity filter residues to alter pore size and hydrophobicity

    • Based on findings for TIP2;1, where a double mutation affected ammonia but not water permeability , similar mutation strategies could be applied to TIP2-3

    • Systematic replacement of pore-lining residues to identify those critical for substrate selectivity

  • NPA Motif Mutations:

    • Altering the conserved NPA (Asparagine-Proline-Alanine) motifs that are crucial for water selectivity

    • Testing the effect on proton exclusion and water transport efficiency

  • Regulatory Site Mutations:

    • Identifying and mutating potential phosphorylation sites

    • Creating phosphomimetic (Ser/Thr to Asp/Glu) or phospho-null (Ser/Thr to Ala) mutations

    • Targeting potential pH-sensing histidine residues

  • Systematic Approaches:

    • Alanine-scanning mutagenesis of transmembrane domains

    • Creating chimeric proteins by swapping domains between TIP2-3 and other TIPs with different properties

    • Structure-guided mutations based on homology models or molecular dynamics simulations

The effectiveness of mutations can be assessed using the functional assays described earlier, comparing water and ammonia permeability of wild-type and mutant proteins. The finding that a double mutation in TIP2;1 decreased permeability by factors of 2.5 for water and 4 for ammonia suggests that similar quantitative approaches can be applied to TIP2-3.

What is known about the expression pattern of TIP2-3 in different tissues and developmental stages?

While the search results don't provide specific information about the expression pattern of TIP2-3, they do offer insights into the expression patterns of related TIP family members, which may inform our understanding of TIP2-3:

TIP3;1 and TIP3;2 are seed-specific TIP isoforms in Arabidopsis. Their transcripts begin to be detectable in siliques at 12 days post-anthesis (DPA) and increase sharply throughout the maturation phase . In germinating seeds, the levels of TIP3 transcripts decrease to less than 1% during the first 3 hours after germination .

Interestingly, while TIP3 transcript levels decrease rapidly during germination, the protein levels do not decrease significantly within 24 hours but start to decrease sharply 48 hours after germination . At this time point, TIP1 proteins (TIP1;1 and TIP1;2) begin to be detectable, suggesting a developmental switch in TIP isoform expression .

For TIP2-3 specifically, researchers would need to employ techniques such as:

  • Quantitative RT-PCR to measure transcript levels in different tissues and developmental stages

  • Promoter-reporter constructs (e.g., ProTIP2-3:GFP) to visualize expression patterns

  • Immunoblotting with TIP2-3-specific antibodies to detect protein levels

How is TIP2-3 expression regulated at the transcriptional level?

While specific information about TIP2-3 transcriptional regulation is not provided in the search results, insights from related TIP proteins may be relevant:

The TIP3 genes (TIP3;1 and TIP3;2) are regulated by ABSCISIC ACID INSENSITIVE 3 (ABI3), a master regulator that controls seed maturation . ABI3 directly binds to the RY motifs (CATGCA) in the promoters of TIP3 genes . The RY2 motif was found to be particularly essential for TIP3;1 expression in seeds .

TIP3 promoters can be activated by ABI3, but only in the presence of abscisic acid (ABA) . Transient expression of ABI3 alone slightly increased the activity of TIP3 promoters, but addition of ABA caused a drastic induction of promoter activity (279-fold for TIP3;1 and 150-fold for TIP3;2) .

For TIP2-3, potential regulatory elements might include:

  • RY motifs that could be bound by B3-domain transcription factors like ABI3

  • ABA-responsive elements (ABREs)

  • Other hormone-responsive elements

  • Stress-responsive elements

Experimental approaches to study TIP2-3 transcriptional regulation would include:

  • Promoter deletion/mutation analysis to identify key regulatory elements

  • Chromatin immunoprecipitation (ChIP) to identify transcription factors that bind to the TIP2-3 promoter

  • Transient expression assays in protoplasts with candidate transcription factors

What post-translational modifications regulate TIP2-3 activity?

The search results don't provide specific information about post-translational modifications of TIP2-3, but based on studies of other aquaporins, several regulatory mechanisms may be relevant:

  • Phosphorylation:

    • Many aquaporins are regulated by phosphorylation at specific serine or threonine residues

    • Phosphorylation can affect water channel activity, protein trafficking, or protein-protein interactions

    • Key kinases might include SnRK2 (ABA signaling) or CDPK family members

  • pH-Dependent Regulation:

    • Conserved histidine residues can act as pH sensors

    • Protonation state changes under different pH conditions may affect channel gating

  • Trafficking and Localization:

    • Regulation of protein movement between endomembrane compartments and the tonoplast

    • Potential signals in the N- or C-termini that control subcellular targeting

  • Protein-Protein Interactions:

    • Interactions with regulatory proteins that modulate channel activity

    • Homo- or hetero-oligomerization with other TIPs affecting function

Experimental approaches to study post-translational modifications of TIP2-3 would include:

  • Phosphoproteomic analysis to identify phosphorylation sites

  • Site-directed mutagenesis of potential regulatory residues

  • Protein-protein interaction studies using co-immunoprecipitation or yeast two-hybrid assays

  • Subcellular localization studies under different conditions to assess trafficking regulation

What role might TIP2-3 play in stress responses in Arabidopsis?

While the search results don't directly address the role of TIP2-3 in stress responses, as a tonoplast aquaporin, it likely contributes to water homeostasis and potentially to stress adaptation mechanisms:

  • Drought Stress Response:

    • Facilitation of water movement between cytoplasm and vacuole

    • Contribution to osmotic adjustment during water deficit

    • Potential role in regulating vacuolar water storage and release

  • Oxidative Stress Management:

    • Based on findings for TIP3 proteins, which may play a role in controlling hydrogen peroxide levels , TIP2-3 might similarly contribute to oxidative stress management

    • The tip3;1/tip3;2 double mutant accumulated high levels of hydrogen peroxide compared to wild type , suggesting a role in ROS regulation

  • Nutrient Stress Adaptation:

    • Potential role in nitrogen metabolism if TIP2-3 transports ammonia, similar to TIP2;1

    • Contribution to vacuolar storage of nutrients during stress conditions

  • Hormonal Stress Signaling:

    • Possible involvement in ABA-mediated stress responses, given the regulation of related TIPs by ABI3 in the presence of ABA

    • Integration with other hormone signaling pathways for stress adaptation

Experimental approaches to study TIP2-3's role in stress responses would include:

  • Expression analysis under various stress conditions

  • Phenotypic characterization of TIP2-3 knockout or overexpression lines under stress

  • Physiological measurements of water relations in mutant versus wild-type plants

  • Metabolomic analysis to assess changes in stress-related metabolites

How can molecular dynamics simulations advance our understanding of TIP2-3 function?

Molecular dynamics (MD) simulations offer powerful tools for understanding the structure-function relationship of TIP2-3 at the atomic level. Based on the approach used for TIP2;1 , similar computational methods can be applied to TIP2-3:

  • Permeability Calculations:

    • Microsecond-long MD simulations using force fields such as CHARMM36 and Amber ff99SB-ILDN

    • Calculation of permeabilities for water, ammonia, and other potential substrates

    • Comparison of substrate preferences based on calculated permeabilities

  • Free Energy Profiles:

    • Determination of free energy barriers along the channel axis for different substrates

    • Identification of energy wells and barriers that affect substrate selectivity

    • Correlation of energy profiles with structural features of the channel

  • Mutation Effects:

    • In silico mutations to predict their effects on channel function

    • Comparison with experimental data from mutational studies

    • As seen with TIP2;1, where a double mutant showed decreased permeability by factors of 2.5 for water and 4 for ammonia

  • Structural Dynamics:

    • Analysis of protein conformational changes during substrate transport

    • Identification of gating mechanisms and conformational transitions

    • Correlation of dynamics with functional properties

  • Substrate Pathway Mapping:

    • Visualization of preferred pathways for different substrates through the channel

    • Identification of key interaction sites along the transport pathway

    • Comparison of pathways for different substrates like water and ammonia

These computational approaches can complement experimental studies and provide atomic-level insights that are difficult to obtain experimentally, particularly for membrane proteins like TIP2-3.

What approaches can identify protein interaction partners of TIP2-3?

Identifying protein interaction partners of TIP2-3 is crucial for understanding its cellular functions and regulatory networks. Several complementary approaches can be used:

  • Affinity-Based Methods:

    • Co-immunoprecipitation (Co-IP) with TIP2-3-specific antibodies

    • Pull-down assays using tagged recombinant TIP2-3

    • Tandem affinity purification followed by mass spectrometry

  • Proximity-Based Methods:

    • BioID or APEX2 proximity labeling fused to TIP2-3

    • Chemical cross-linking followed by mass spectrometry (XL-MS)

    • Förster resonance energy transfer (FRET) with fluorescently tagged proteins

  • Genetic and Genomic Approaches:

    • Yeast two-hybrid screening, preferably using split-ubiquitin systems for membrane proteins

    • Genetic suppressor screens to identify functional interactions

    • Co-expression analysis to identify genes with similar expression patterns

  • In Planta Validation:

    • Bimolecular fluorescence complementation (BiFC) to visualize interactions in plant cells

    • Co-localization studies using confocal microscopy

    • Functional complementation assays in mutant backgrounds

  • Structural Approaches:

    • Cryo-electron microscopy of purified protein complexes

    • Native PAGE to identify stable protein complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

The interactome of TIP2-3 likely includes other tonoplast proteins, regulatory kinases and phosphatases, trafficking machinery, and potentially other aquaporins. Understanding these interactions will provide insights into how TIP2-3 is regulated and integrated into cellular processes.

How can researchers develop TIP2-3 with modified transport properties through protein engineering?

Protein engineering approaches can be used to modify the transport properties of TIP2-3 for both research and potential biotechnological applications:

  • Rational Design Based on Structure-Function Knowledge:

    • Targeted mutations of the ar/R selectivity filter to alter substrate specificity

    • Modifications of the NPA motifs to change water selectivity

    • Engineering of gating regions to create constitutively active channels

    • Based on findings from TIP2;1, where specific mutations affected ammonia transport without altering water permeability

  • Domain Swapping and Chimeric Proteins:

    • Creating chimeras between TIP2-3 and other aquaporins with different selectivity profiles

    • Swapping loops or transmembrane domains to confer novel properties

    • Fusion with regulatory domains to create channels responsive to specific stimuli

  • Directed Evolution:

    • Random mutagenesis coupled with functional screening

    • Selection systems based on growth complementation in yeast or bacteria

    • Iterative improvement of desired properties through multiple rounds of selection

  • Computational Design:

    • Using MD simulations to predict the effects of mutations

    • Structure-based computational design of pore architecture

    • Virtual screening of mutant libraries before experimental testing

  • Post-Translational Regulation Engineering:

    • Modifying phosphorylation sites to create constitutively active or inactive forms

    • Engineering pH sensitivity by altering histidine residues

    • Creating channels with novel regulatory properties

Potential applications of engineered TIP2-3 variants include:

  • Research tools to study specific transport pathways

  • Plants with improved drought resistance through optimized water transport

  • Enhanced nutrient utilization through modified transport of nitrogen compounds

  • Biosensors for detecting specific substrates or conditions

What are the current technical limitations in TIP2-3 research?

Several technical challenges currently limit our understanding of TIP2-3 function and regulation:

  • Structural Characterization:

    • Difficulty in obtaining high-resolution structures of plant membrane proteins

    • Challenges in crystallizing aquaporins in different conformational states

    • Limited information on the structure-function relationship specific to TIP2-3

  • Functional Redundancy:

    • Overlapping functions with other TIP family members may mask phenotypes in single mutants

    • As noted in the search results, "TIP gene loss-of-function mutants do not show obvious phenotypes, probably due to the functional redundancy between different TIPs"

    • Need for higher-order mutants and careful phenotypic analysis

  • Transport Measurements:

    • Technical challenges in accurately measuring water and solute transport

    • Difficulty in distinguishing between substrates in mixed transport assays

    • Need for sensitive and specific probes for different substrates

  • In Vivo Regulation:

    • Limited understanding of how TIP2-3 is regulated in planta under different conditions

    • Difficulty in studying dynamic changes in transport activity

    • Complex interplay between different regulatory mechanisms

  • Expression and Purification:

    • Challenges in obtaining sufficient quantities of properly folded recombinant protein

    • Potential differences between recombinant proteins and native TIP2-3 in terms of post-translational modifications

    • Ensuring that purified protein retains native conformation and activity

Addressing these limitations will require interdisciplinary approaches combining structural biology, molecular genetics, biophysics, and computational biology.

What emerging technologies might advance TIP2-3 research?

Several emerging technologies hold promise for advancing our understanding of TIP2-3:

  • Advanced Structural Biology Techniques:

    • Cryo-electron microscopy for high-resolution structure determination without crystallization

    • Integrative structural biology combining multiple data sources

    • Time-resolved structural methods to capture conformational changes during transport

  • Single-Molecule Approaches:

    • Single-molecule FRET to observe conformational dynamics

    • Single-channel recordings to measure transport at the individual protein level

    • Super-resolution microscopy to visualize TIP2-3 distribution and dynamics in membranes

  • Genome Editing Technologies:

    • CRISPR/Cas9 for precise genetic manipulation in Arabidopsis

    • Creation of tagged endogenous TIP2-3 to study native protein

    • Multiplexed editing to address functional redundancy with other TIPs

  • Advanced Computational Methods:

    • Enhanced sampling techniques for more efficient molecular dynamics simulations

    • Machine learning approaches for predicting structure-function relationships

    • Systems biology modeling to integrate TIP2-3 function into cellular pathways

  • Single-Cell Technologies:

    • Single-cell transcriptomics to capture cell-specific expression patterns

    • Single-cell proteomics to identify cell-specific interactomes

    • Microfluidic approaches for single-cell physiological measurements

  • Synthetic Biology Approaches:

    • Reconstitution of minimal systems to study TIP2-3 in controlled environments

    • Development of synthetic regulatory circuits to control TIP2-3 expression

    • Creation of novel biomimetic membranes incorporating engineered TIP2-3

These technologies will provide new insights into TIP2-3 function and may lead to applications in agriculture and biotechnology.

What unexplored aspects of TIP2-3 warrant further investigation?

Several aspects of TIP2-3 biology remain unexplored and represent important areas for future research:

  • Substrate Specificity Beyond Water:

    • Given that TIP2;1 transports both water and ammonia , comprehensive characterization of TIP2-3's substrate range is needed

    • Potential transport of signaling molecules, metabolites, or reactive oxygen species

    • Transport kinetics and selectivity mechanisms for different substrates

  • Tissue-Specific Functions:

    • Detailed analysis of expression patterns in different tissues and cell types

    • Physiological roles in specific tissues and developmental contexts

    • Potential specialization for tissue-specific functions

  • Stress-Responsive Regulation:

    • Dynamic regulation under various abiotic and biotic stresses

    • Integration with hormone and stress signaling pathways

    • Contribution to stress adaptation mechanisms

  • Interaction with Vacuolar Physiology:

    • Role in vacuolar pH regulation

    • Contribution to vacuolar storage functions

    • Interaction with other vacuolar transporters and channels

  • Evolutionary Context:

    • Evolutionary history of TIP2-3 and related aquaporins

    • Comparative analysis across different plant species

    • Adaptive significance of TIP2-3 properties in different ecological contexts

  • Agricultural Applications:

    • Potential for improving crop water use efficiency

    • Role in nutrient utilization and translocation

    • Contribution to stress resilience in agricultural contexts

  • Regulatory Networks:

    • Comprehensive identification of transcription factors controlling TIP2-3 expression

    • Integration with cellular signaling networks

    • Coordination with other water transport systems in the plant

Addressing these unexplored aspects will provide a more complete understanding of TIP2-3 biology and may lead to practical applications in agriculture and biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.