Recombinant Arabidopsis thaliana ATP-dependent zinc metalloprotease FTSH 1, chloroplastic (FTSH1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Arabidopsis thaliana ATP-dependent Zinc Metalloprotease FTSH 1, Chloroplastic (FTSH1)

Arabidopsis thaliana ATP-dependent zinc metalloprotease FTSH 1, chloroplastic (FTSH1), also known as FtsH protease, is an essential ATP-dependent metalloprotease that resides in the thylakoid membrane of Arabidopsis thaliana chloroplasts . FtsH is crucial for protein quality control within the chloroplast and is involved in the degradation of damaged proteins, particularly the D1 protein in photosystem II (PSII) .

Role in Chloroplast Function and Development

FTSH1 is essential for chloroplast development during leaf growth . Specifically, it participates in the degradation of the photo-damaged D1 protein in the PSII complex, which is critical for maintaining photosynthetic activity . Mutants with reduced FTSH12 abundance show impaired plastid development, with pale cotyledons and deformed chloroplasts exhibiting altered thylakoid structure .

Interactions and Complex Formation

FTSH1 interacts with other FtsH family members to form heterohexameric complexes . These complexes are crucial for the proteolytic activity and stability of the thylakoid membrane . The composition of the translocon on the inner chloroplast membrane (TIC) protein import complex can be altered by changes in FTSH12 abundance, which affects plastid development .

Regulation by Phosphorylation

FtsH phosphorylation is a regulatory mechanism in the thylakoid membrane . Both type A (FtsH1/5) and type B (FtsH2/8) subunits can be separated into phosphorylated and non-phosphorylated forms . Although light conditions and major thylakoid kinases (STN7 and STN8) do not significantly affect FtsH phosphorylation, the phosphorylation status may influence FtsH complex formation or stability . Ser-212 may also play a role in FtsH stability in thylakoid membranes .

Impact of FTSH1 Abundance

The abundance of FTSH1 affects chloroplast development, particularly during seedling development . Reduced FTSH12 abundance leads to impaired plastid development and altered thylakoid structure . Conversely, overexpression of FTSH12, while not causing an obvious phenotype, results in distinct proteome differences .

Research Techniques Used

Several research techniques are employed to study FtsH proteases:

  • Proteomic methods: Used to identify fragments of substrate proteins and changes in the proteome of FtsH protease-deficient mutants .

  • Phos-Tag SDS-PAGE: Used to assess the phosphorylation status of FtsH .

  • Site-directed mutagenesis: Employed to investigate the role of specific amino acid residues in FtsH function and stability .

  • In vitro assays: Used to study the dynamics of FtsZ proteins in chloroplast division .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
FTSH1; AAA; FTSH; At1g50250; F14I3.14; ATP-dependent zinc metalloprotease FTSH 1, chloroplastic; AtFTSH1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
87-716
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FTSH1
Target Protein Sequence
VVDEPASPSVVIESQAVKPSTPSPLFIQNEILKAPSPKSSDLPEGSQWRYSEFLNAVKKG KVERVRFSKDGSVVQLTAVDNRRASVIVPNDPDLIDILAMNGVDISVSEGESSGNDLFTV IGNLIFPLLAFGGLFLLFRRAQGGPGGGPGGLGGPMDFGRSKSKFQEVPETGVSFADVAG ADQAKLELQEVVDFLKNPDKYTALGAKIPKGCLLVGPPGTGKTLLARAVAGEAGVPFFSC AASEFVELFVGVGASRVRDLFEKAKSKAPCIVFIDEIDAVGRQRGAGMGGGNDEREQTIN QLLTEMDGFSGNSGVIVLAATNRPDVLDSALLRPGRFDRQVTVDRPDVAGRVKILQVHSR GKALGKDVDFDKVARRTPGFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGP EKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLE SGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKI GQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHK LAQLLIEKETVDGEEFMSLFIDGQAELYIS
Uniprot No.

Target Background

Function
This protein is part of a complex functioning as an ATP-dependent zinc metallopeptidase. It plays a crucial role in thylakoid formation and the removal of damaged D1 protein in photosystem II, thereby preventing cell death under high-light conditions.
Gene References Into Functions
  1. Research indicates that both protein activity and quantity are critical factors in the function of FtsH heterocomplexes, which are composed of multiple isoforms within the thylakoid membrane. PMID: 21062893
  2. In darkness, some FtsH hexamers are positioned adjacent to PSII complexes in the grana, enabling the prompt degradation of photodamaged D1 protein under light stress. PMID: 20921219
Database Links

KEGG: ath:AT1G50250

STRING: 3702.AT1G50250.1

UniGene: At.21777

Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein; Stromal side.
Tissue Specificity
Ubiquitous.

Q&A

What is the structure and organization of FTSH1 protein domains?

FTSH1 contains several distinct domains with specific functions:

  • N-terminal region: Contains two transmembrane α-helices that anchor the protein to the thylakoid membrane

  • ATPase domain: Follows the transmembrane regions and belongs to the AAA+ superfamily of proteins

  • Proteolytic domain: Located at the C-terminus and contains the zinc-binding motif H-E-X-X-H that serves as the active site

The full-length mature protein spans amino acids 87-716, with a molecular weight of approximately 71 kDa . The crystal structure studies of related FtsH proteins suggest that they form ring-like hexamers, with the ATP binding motifs facing the center of the ring .

How is FTSH1 classified within the FtsH family in Arabidopsis?

FTSH1 is classified as a Type A subunit, along with FTSH5 (also known as VAR1). These are phylogenetically distinct from Type B subunits (FTSH2/VAR2 and FTSH8) . This classification is important because:

FtsH TypeMembersRelative AbundanceGenetic Relationship
Type AFTSH1, FTSH5FTSH5 (~60% of FTSH2), FTSH1 (~10% of FTSH2)Duplicated genes
Type BFTSH2, FTSH8FTSH2 (most abundant), FTSH8 (~50% of FTSH2)Duplicated genes

The functional FtsH complexes in thylakoid membranes require both Type A and Type B subunits .

What is known about FTSH1 expression and accumulation under normal conditions?

FTSH1 is one of only four FtsH isoforms (FTSH1, FTSH2, FTSH5, and FTSH8) that have been detected in Arabidopsis leaves grown under optimal conditions . Among these, FTSH1 is the least abundant, accumulating to only about 10% of the level of FTSH2 . This differential accumulation appears to correlate with their functional significance, as mutations in the more abundant FTSH2 and FTSH5 result in more severe phenotypes than mutations in FTSH1 .

What are the best approaches for expressing and purifying recombinant FTSH1?

For successful expression and purification of recombinant FTSH1:

  • Expression system selection:

    • E. coli is commonly used but may require co-expression with the RIG plasmid to overcome codon bias issues when expressing Arabidopsis proteins

    • Consider expressing only the mature protein (amino acids 87-716) or specific domains rather than the full-length protein including transit peptide

  • Construct design strategies:

    • For full-length protein: Use His-tag, GST, or MBP fusion tags at the N-terminus

    • For functional studies: Express the conserved ATPase and protease domains (amino acids ~115-612)

    • Avoid the transmembrane domains if solubility is a concern

  • Purification protocol:

    • Two-step purification yields best results: Affinity chromatography (Ni-NTA for His-tagged proteins) followed by ion exchange chromatography (HiTrap SP HP column)

    • Consider protein solubilization with mild detergents like Triton X-100 (0.25-1%) to maintain native structure

Note that full-length FTSH1 can be difficult to express at high levels, and expressing specific domains may yield better results for biochemical studies .

How can I generate and validate FTSH1 mutants in Arabidopsis?

To generate and properly validate FTSH1 mutants:

  • Mutant generation approaches:

    • T-DNA insertion lines are available through stock centers (check NASC, ABRC)

    • CRISPR/Cas9 can be used for targeted mutagenesis

    • For point mutations in functional domains, site-directed mutagenesis in complementation constructs is effective

  • Validation methods:

    • PCR-based genotyping with gene-specific primers flanking the insertion site and T-DNA border primers

    • RT-PCR and qRT-PCR to confirm transcript absence/reduction

    • Western blotting with anti-FTSH1 antibodies to confirm protein absence

    • Complementation with wild-type FTSH1 to confirm phenotype rescue

  • Critical controls:

    • Include appropriate single and multiple mutant combinations (particularly ftsh1 ftsh5 and ftsh1 ftsh2) to account for functional redundancy

    • Compare phenotypes under both standard growth conditions and stress conditions (high light, senescence, etc.)

What methods are recommended for studying FTSH1 interactions with other proteins?

For investigating FTSH1 protein interactions:

  • In vivo approaches:

    • Co-immunoprecipitation with anti-FTSH1 antibodies

    • Chemical cross-linking with DSP followed by reducing treatment with DTT to analyze oligomeric states

    • Blue Native PAGE to identify native complexes and their sizes

    • Bimolecular Fluorescence Complementation (BiFC) for specific interaction pairs

  • In vitro approaches:

    • Pull-down assays with recombinant proteins

    • Surface Plasmon Resonance (SPR) for interaction kinetics

    • Yeast two-hybrid screening for novel interactors

Using these approaches, researchers have demonstrated that FTSH1 forms oligomeric complexes with other FtsH proteins, particularly with FTSH2, FTSH5, and FTSH8 . Additionally, interactions with GUN1 have been identified, suggesting FTSH1's role in retrograde signaling .

How do FTSH1 and other FtsH proteins coordinate to maintain chloroplast homeostasis?

The coordination between FTSH1 and other FtsH proteins involves:

  • Complex formation dynamics:

    • FtsH proteins form heterohexameric complexes in the thylakoid membrane

    • These complexes require both Type A (FTSH1, FTSH5) and Type B (FTSH2, FTSH8) subunits

    • Blue Native PAGE analysis reveals complexes of approximately 450 kDa, representing the hexameric form

  • Functional redundancy patterns:

    • Within each type: FTSH1 can partially compensate for FTSH5 loss, and FTSH8 can partially compensate for FTSH2 loss

    • Between types: Both types are essential, as complete loss of either Type A or Type B leads to albino seedlings

  • Research evidence:

    • Double mutant analysis shows that disruption of FTSH1 enhances the phenotype of the ftsh2 mutant but not to the severity seen in ftsh2 ftsh5 double mutants

    • This indicates a hierarchy of importance: FTSH2 > FTSH5 > FTSH1 = FTSH8, which correlates with their relative abundance in the thylakoid membrane

The coordinated function of these proteases is essential for proper chloroplast development, and understanding their interactions is key to elucidating the molecular mechanisms of chloroplast biogenesis and maintenance.

What is the role of FTSH1 in the repair of photodamaged Photosystem II?

FTSH1 contributes to PSII repair through:

To study this process, researchers commonly use high-light treatment followed by measurements of PSII efficiency (Fv/Fm), D1 protein turnover rates, and recovery kinetics.

How does FTSH1 interact with the chloroplast protein import and quality control machinery?

FTSH1's relationship with protein import and quality control involves:

  • Interaction with GUN1:

    • GUN1 is a chloroplast-localized pentatricopeptide repeat protein involved in retrograde signaling

    • Co-immunoprecipitation and protein-protein interaction assays have identified FTSH1 as a GUN1-interacting protein

    • GUN1 influences the accumulation of FtsH subunits in thylakoid membranes, including FTSH1

  • Role in protein homeostasis:

    • FTSH1 is involved in the degradation of unassembled thylakoid proteins

    • GUN1 and the thylakoid FtsH protease complex (including FTSH1) are essential for proper chloroplast biogenesis and accumulation of fully developed lens-shaped chloroplasts

  • Connection to protein import:

    • In the absence of GUN1, chloroplast precursor proteins (potentially including FTSH1 precursors) accumulate in the cytosol

    • This affects the entire chloroplast import machinery, leading to increased protein ubiquitination and cytosolic chaperone abundance

Understanding these interactions is crucial for elucidating how chloroplast development and function are maintained under varying environmental conditions.

Why is it difficult to observe phenotypes in single ftsh1 mutants, and how can this be addressed?

The challenge with ftsh1 single mutants stems from:

  • Functional redundancy:

    • FTSH1 functions are partially redundant with other Type A FtsH proteins, particularly FTSH5

    • FTSH1 is the least abundant of the four major thylakoid FtsH proteins, suggesting it may play a secondary role

  • Experimental approaches to reveal ftsh1 phenotypes:

    • Generate double or triple mutants (e.g., ftsh1 ftsh2, ftsh1 ftsh5) to overcome redundancy

    • Apply stress conditions such as high light, where the cumulative activity of all FtsH proteins becomes limiting

    • Analyze subtle phenotypes using sensitive techniques like chlorophyll fluorescence measurements

    • Examine molecular phenotypes (protein accumulation, repair kinetics) rather than visual phenotypes

  • Evidence from previous studies:

    • While ftsh1 single mutants show no obvious phenotype, ftsh1 ftsh2 double mutants show enhanced leaf variegation compared to ftsh2 single mutants

    • This indicates that FTSH1 does contribute to chloroplast biogenesis, but its role becomes apparent only when other FtsH proteins are compromised

What factors should be considered when designing site-directed mutagenesis experiments for FTSH1?

For effective site-directed mutagenesis of FTSH1:

  • Key functional domains to target:

    • ATPase domain: Contains Walker A and B motifs and the second region of homology (SRH) crucial for ATP hydrolysis

    • Protease domain: Contains the zinc-binding motif H-E-X-X-H essential for proteolytic activity

    • Transmembrane domains: Important for proper membrane insertion and complex formation

  • Critical residues based on previous studies:

    • The first histidine residue in the zinc-binding motif (H-E-X-X-H): Substitution to leucine (H417L) leads to complete loss of protease activity

    • Potential phosphorylation sites: S292, T337, S380, and S393 have been identified as putative regulatory sites

    • G195: Mutation to aspartic acid (G195D) affects FtsH function

  • Complementation strategies:

    • Express mutated versions under native or 35S promoters in ftsh1 single mutants or ftsh1 ftsh5 double mutants

    • Include appropriate epitope tags (HA, GFP) for detection while ensuring they don't interfere with function

    • Use site-specific recombination systems (Gateway) for efficient cloning of multiple variants

Careful assessment of both biochemical activity (in vitro) and in vivo complementation is essential to fully understand the impact of specific mutations.

How can researchers distinguish between the roles of different FtsH proteins when studying chloroplast development?

To differentiate the specific roles of FTSH1 from other FtsH proteins:

  • Genetic approaches:

    • Create comprehensive mutant collections covering all combinations of ftsh mutants

    • Use inducible silencing or degradation systems to overcome seedling lethality of some double mutants

    • Develop tissue-specific or developmentally regulated knockout/knockdown systems

  • Biochemical differentiation strategies:

    • Use specific antibodies that can distinguish between different FtsH proteins

    • Employ tagged versions of FTSH proteins to track their individual incorporation into complexes

    • Analyze substrate specificity through in vitro assays with recombinant proteins

  • Comparison of mutant phenotypes:

    Mutant CombinationPhenotypeSignificance
    ftsh1No obvious phenotypeFTSH1 alone is not essential
    ftsh2 (var2)Leaf variegationFTSH2 is a major contributor to chloroplast development
    ftsh5 (var1)Mild leaf variegationFTSH5 contributes significantly but less than FTSH2
    ftsh1 ftsh2Enhanced variegation compared to ftsh2FTSH1 contributes when FTSH2 is absent
    ftsh1 ftsh5Severe phenotype (albinism, heterotrophy)Type A subunits (FTSH1+FTSH5) are collectively essential
    ftsh2 ftsh8Severe phenotype (albinism)Type B subunits are collectively essential

These approaches collectively allow researchers to dissect the specific contribution of FTSH1 to chloroplast biogenesis and maintenance, despite the functional overlap within the FtsH family.

What are the emerging techniques for studying FTSH1 dynamics in living plant cells?

Cutting-edge approaches for investigating FTSH1 dynamics include:

  • Advanced imaging techniques:

    • FRAP (Fluorescence Recovery After Photobleaching) using FTSH1-GFP fusions to study mobility within the thylakoid membrane

    • Super-resolution microscopy (STORM, PALM) to visualize FTSH1 distribution at nanometer resolution

    • Single-molecule tracking to monitor real-time movement and interactions

  • Proximity-based protein interaction methods:

    • BioID or TurboID fusions to FTSH1 for identifying transient interactions through proximity labeling

    • APEX2-based approaches for spatially restricted proteomics around FTSH1

    • Split-protein complementation systems optimized for chloroplast use

  • Rapid manipulation systems:

    • Optogenetic tools adapted for chloroplast use to control FTSH1 activity with light

    • Chemical-inducible degradation systems to rapidly deplete FTSH1 protein

    • Nanobody-based tools to inhibit specific FTSH1 interactions

These techniques will help resolve the temporal and spatial aspects of FTSH1 function during chloroplast development and stress responses.

How might computational approaches enhance our understanding of FTSH1 function?

Computational methods offer powerful tools for FTSH1 research:

  • Structural modeling approaches:

    • Molecular dynamics simulations of FTSH1 complexes in membrane environments

    • Substrate docking simulations to predict interaction sites and specificity determinants

    • Homology modeling based on recently solved structures of bacterial FtsH proteins

  • Systems biology approaches:

    • Network analysis integrating transcriptomics, proteomics, and metabolomics data from ftsh mutants

    • Machine learning to identify patterns in phenotypic data across different stress conditions

    • Flux balance analysis to model the impact of altered FtsH activity on chloroplast metabolism

  • Evolutionary analyses:

    • Comparative genomics across plant species to identify conserved regulatory elements

    • Positive selection analysis to identify functionally important residues

    • Co-evolution analysis to predict protein-protein interaction interfaces

These computational approaches, when integrated with experimental data, can generate testable hypotheses about FTSH1 function and regulation.

What is the potential for exploiting knowledge of FTSH1 to improve plant stress tolerance?

Translational applications of FTSH1 research include:

  • Strategies for engineering enhanced stress tolerance:

    • Fine-tuning FTSH1 expression levels to optimize PSII repair capacity

    • Engineering modified FTSH1 proteins with enhanced substrate recognition or catalytic efficiency

    • Creating synthetic regulatory circuits to coordinate FTSH1 activity with stress perception

  • Evidence supporting feasibility:

    • The correlation between FtsH activity and photoinhibition resistance suggests that enhancing FTSH1 function could improve high light tolerance

    • The connection between FTSH1 and GUN1 suggests potential for improving retrograde signaling during stress

    • The sensitivity of ftsh mutants to field conditions indicates ecological relevance of FTSH function

  • Important considerations:

    • Balance between FTSH1 and other FtsH proteins must be maintained

    • Energy costs of overexpressing proteases must be accounted for

    • Tissue-specific or condition-specific expression may be preferable to constitutive enhancement

These applications represent promising directions for translating fundamental knowledge about FTSH1 into improved crop resilience.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.