Recombinant Arabidopsis thaliana ATP-dependent zinc metalloprotease FTSH 10, mitochondrial (FTSH10)

Shipped with Ice Packs
In Stock

Description

General Information

Arabidopsis thaliana contains 12 FTSH genes that potentially code for functional proteases . Among these, AtFtsH3 and AtFtsH10 have been identified in mitochondria . FTSH proteases are membrane-bound and contain an AAA+ (ATPase associated with various cellular activities) domain and a Zn2+ metalloprotease domain .

Function and Characteristics

AtFtsH3 and AtFtsH10 assemble with prohibitins into high molecular weight complexes of approximately 2 MDa, similar to their yeast counterparts . These proteases can form both homo- and hetero-oligomers . In Arabidopsis mutants lacking AtFtsH3 (ftsh3), the level of AtFtsH10 increases, suggesting that AtFtsH10 homo-oligomers can partially substitute for the functions of complexes containing AtFtsH3 .

FtsH Complexes

AtFtsH3 and AtFtsH10 form at least two types of m-AAA-PHB complexes in wild-type plants . One type contains PHBs and AtFtsH3, and the other contains PHBs, AtFtsH3, and AtFtsH10 . Complexes composed of PHBs and AtFtsH10 are found in the Arabidopsis mutant ftsh3 .

Interaction with Complex I

FTSH3 facilitates the degradation of Complex I (CI) in Arabidopsis thaliana . The ATPase domain of FTSH3, rather than its proteolytic domain, is responsible for CI matrix arm disassembly in CI-defective backgrounds .

Research methods

Research methods used to study FtsH proteases in Arabidopsis thaliana include:

  • Field studies to determine Darwinian fitness

  • Proteomic methods to discover fragments of substrate proteins and changes in the proteome of FtsH protease-deficient mutants

Table Summarizing FTSH10 Characteristics

CharacteristicDescription
Protein NameRecombinant Arabidopsis thaliana ATP-dependent zinc metalloprotease FTSH 10, mitochondrial (FTSH10)
FamilyFtsH protease family
LocationMitochondria
FunctionATP-dependent zinc metalloprotease involved in protein turnover and regulation
Complex FormationAssembles with prohibitins into high molecular weight complexes; forms homo- and hetero-oligomers with AtFtsH3
RegulationIncreased synthesis in ftsh3 mutants
Phenotype of MutantsSingle knock-outs show no phenotype under controlled conditions; reduced seed production and reddish leaves observed in the field for ftsh10 mutants
Role in Complex I DegradationFTSH3 facilitates Complex I degradation via its ATPase domain

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
FTSH10; At1g07510; F22G5.10; F22G5_9; ATP-dependent zinc metalloprotease FTSH 10, mitochondrial; AtFTSH10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
87-813
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FTSH10
Target Protein Sequence
SSQTPKKKNYENYYPKDSKKAPKNEQKSESRDGSKKNENENAGDAFSNEYQNMLIPLMAI ALILSTFSLGSREQQQISFQEFKNKLLEAGLVDHIDVSNKEVAKVYVRSSPKSQTTEEVV QGPGNGVPAKGRGGQYKYYFNIGSVESFEEKLEEAQEAIGVNSHDFVPVTYVSETIWYQE LLRFAPTLLLVATLIFGARRMQGGLGGLGGPGGKAGRGIFNIGKAQITRADKNSKNKIYF KDVAGCEEAKQEIMEFVHFLQNPKKYEDLGAKIPKGALLVGPPGTGKTLLAKATAGESAV PFLSISGSDFMEMFVGVGPSRVRNLFQEARQCAPSIIFIDEIDAIGRARGRGGFSGGNDE RESTLNQLLVEMDGFGTTAGVVVLAGTNRPDILDKALLRPGRFDRQITIDKPDIKGRDQI FQIYLKKIKLDHEPSYYSQRLAALTPGFAGADIANVCNEAALIAARHEGATVTMAHFDSA IDRVIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQ YVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFS DKIGLLSFPQREDEFSKPYSNRTGAMIDEEVREWVGKAYKRTVELIEEHKEQVAQIAELL LEKEVLHQDDLTKVLGERPFKSGETTNYDRFKSGFEESEKESQKESVPVKPVEDDGIPPL EPQVVPT
Uniprot No.

Target Background

Function

This recombinant Arabidopsis thaliana ATP-dependent zinc metalloprotease FTSH 10, mitochondrial (FTSH10), likely functions as an ATP-dependent zinc metallopeptidase. It is involved in the assembly and/or stabilization of mitochondrial oxidative phosphorylation complexes I and V.

Database Links

KEGG: ath:AT1G07510

STRING: 3702.AT1G07510.1

UniGene: At.23339

Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Q&A

What is the cellular localization of AtFtsH10 in Arabidopsis thaliana?

AtFtsH10 is specifically localized in the mitochondria of Arabidopsis thaliana. It is classified as a matrix (m)-AAA protease, which indicates its positioning on the matrix side of the inner mitochondrial membrane. This localization is critical for its function in protein quality control within the mitochondrial compartment . Unlike some other FtsH family members that localize to chloroplasts or thylakoid membranes, AtFtsH10 is distinctly mitochondrial, which explains its involvement in mitochondrial-specific processes rather than chloroplastic functions.

How does AtFtsH10 interact with other proteins in the mitochondria?

AtFtsH10 forms complexes with other proteins in the mitochondria, particularly with AtFtsH3 (another m-AAA protease) and prohibitins. These interactions can take the form of both homo-oligomeric complexes (consisting only of AtFtsH10 subunits) and hetero-oligomeric complexes (containing both AtFtsH10 and AtFtsH3) . These protein complexes are believed to form hexameric ring structures typical of AAA-proteases, as observed in related proteases like the bacterial FtsH . The interaction with prohibitins suggests a regulatory role, as prohibitins are known to modulate the activity of FtsH proteases in various organisms. This protein-protein interaction network is essential for the proper functioning of mitochondrial protein quality control systems.

What happens to AtFtsH10 expression when AtFtsH3 is absent?

When AtFtsH3 is absent (in ftsh3 mutants), there is a significant increase in the level of AtFtsH10 protein. Interestingly, this upregulation occurs at the translational rather than transcriptional level. The steady-state level of AtFtsH10 transcripts remains unchanged in ftsh3 mutants compared to wild-type plants, but approximately twice as many AtFtsH10 transcripts are associated with polysomes in the mutant . This suggests that AtFtsH10 protein is synthesized at a higher rate in the absence of AtFtsH3, indicating a compensatory mechanism where AtFtsH10 homo-oligomers may partially substitute for the functions normally performed by AtFtsH3-containing complexes.

What is the general structure of FtsH proteases like AtFtsH10?

FtsH proteases, including AtFtsH10, belong to the family of ATP-dependent zinc metalloproteases. They typically contain:

  • An N-terminal transmembrane domain that anchors the protein to the membrane

  • An AAA (ATPases Associated with diverse cellular Activities) domain that binds and hydrolyzes ATP

  • A metalloprotease domain containing the HEXXH motif that coordinates a zinc ion essential for proteolytic activity

The crystal structure analysis of FtsH proteases has revealed some surprising features, including an aspartic acid serving as the third zinc ligand and a breakdown of the expected hexagonal symmetry in the AAA ring . This structure allows these proteins to use ATP hydrolysis to power conformational changes that facilitate the unfolding and subsequent degradation of substrate proteins.

What are the specific substrates of AtFtsH10 in Arabidopsis mitochondria, and how do they differ from other FtsH protease substrates?

While the search results don't directly identify specific substrates of AtFtsH10, research on FtsH proteases in other systems suggests they target misfolded or damaged membrane proteins. In bacteria such as E. coli, FtsH is involved in the quality control of membrane proteins, regulation of response to heat shock, superoxide stress, and viral infection, as well as control of lipopolysaccharide biosynthesis .

In plant mitochondria, m-AAA proteases like AtFtsH10 likely have similar quality control functions, participating in the degradation of non-assembled or damaged mitochondrial proteins. The homo-oligomeric and hetero-oligomeric complexes formed by AtFtsH10 and AtFtsH3 may have partially overlapping but distinct substrate specificities . This is supported by the observation that AtFtsH10 can partially compensate for the loss of AtFtsH3, suggesting some redundancy in substrate recognition.

A comprehensive proteomics approach comparing wild-type and ftsh10 mutant mitochondria under various stress conditions would be necessary to definitively identify the specific substrates of AtFtsH10.

How does the regulation of AtFtsH10 differ under various stress conditions?

Based on studies of FtsH proteases in cyanobacteria, it's likely that AtFtsH10 regulation is responsive to various stress conditions. In cyanobacteria, FtsH proteases are involved in response to nutrient stresses, high irradiance, and other abiotic stressors . Given the conserved nature of these proteases across species, AtFtsH10 may similarly play a role in mitochondrial stress responses in Arabidopsis.

The increased synthesis of AtFtsH10 in ftsh3 mutants suggests a compensatory regulatory mechanism that can be activated when the mitochondrial protein quality control system is compromised . This indicates sophisticated regulatory networks controlling AtFtsH10 expression and activity.

  • Transcriptional and translational regulation under different stresses

  • Post-translational modifications affecting AtFtsH10 activity

  • Changes in complex formation and substrate specificity in response to stress

What is the evolutionary relationship between AtFtsH10 and other FtsH proteases across species?

FtsH proteases are widely distributed in eubacteria, mitochondria, and chloroplasts, suggesting an ancient evolutionary origin. While heterotrophic bacteria typically contain a single indispensable FtsH complex, photosynthetic organisms like cyanobacteria usually contain multiple FtsH complexes, including heterocomplexes and homocomplexes .

In Arabidopsis, there are a total of 12 genes encoding proteolytically active FtsH members, plus an additional 5 genes coding for proteolytically inactive members (FtsHi) . This expansion of the FtsH family in plants likely reflects functional diversification to handle the complex proteostasis needs of plant cells with their multiple membrane-bound compartments.

Phylogenetic analyses of FtsH proteins have shown that FtsH12 and multiple presumably proteolytically inactive FtsHi enzymes share a common evolutionary history, and interestingly, these proteins have commonly disappeared in grasses and gymnosperms . This suggests that different plant lineages have evolved distinct strategies for protein quality control.

The mitochondrial AtFtsH10 likely evolved from the bacterial FtsH proteins that were present in the alpha-proteobacterial ancestor of mitochondria, representing an example of how endosymbiotic organelles have retained and adapted bacterial protein quality control mechanisms.

What molecular mechanisms explain the compensatory upregulation of AtFtsH10 in ftsh3 mutants?

The upregulation of AtFtsH10 in ftsh3 mutants occurs primarily at the translational level rather than the transcriptional level. The steady-state level of AtFtsH10 transcripts remains unchanged, but almost twice more of these transcripts are associated with polysomes in ftsh3 mutants . This suggests several possible molecular mechanisms:

  • Enhanced translation initiation: Regulatory factors might promote the recruitment of AtFtsH10 mRNAs to ribosomes in the absence of AtFtsH3.

  • Increased translation elongation efficiency: The efficiency of translation elongation for AtFtsH10 mRNAs might be increased when AtFtsH3 is absent.

  • Altered mRNA secondary structure: Changes in the cellular environment in ftsh3 mutants might affect the secondary structure of AtFtsH10 mRNAs, making them more accessible to the translation machinery.

  • RNA-binding protein regulation: Specific RNA-binding proteins might preferentially stabilize AtFtsH10 mRNAs in polysomes in the absence of AtFtsH3.

  • Feedback sensing mechanism: A cellular sensing mechanism might detect the absence of functional m-AAA hetero-oligomeric complexes and compensate by promoting AtFtsH10 homo-oligomer formation.

Further research using ribosome profiling, RNA structure analysis, and protein-RNA interaction studies would be necessary to elucidate the exact mechanism of this translational regulation.

What are the optimal protocols for expressing and purifying recombinant AtFtsH10?

Based on general approaches for recombinant FtsH proteins and the information from the search results, the following protocol framework can be suggested:

Expression System Selection:

  • E. coli systems (BL21(DE3) or similar) for basic structural studies

  • Insect cell systems (Sf9 or Hi5) for obtaining properly folded and active protein

  • Plant cell cultures for fully authentic post-translational modifications

Expression Construct Design:

  • Remove the N-terminal mitochondrial targeting sequence

  • Consider adding a solubility tag (MBP, SUMO, or Trx) to improve solubility

  • Include a purification tag (His6 or Strep) at either N- or C-terminus

  • Incorporate a precision protease cleavage site between tags and the protein

Purification Strategy:

  • Cell lysis in buffer containing detergent (e.g., 0.5% DDM or 1% Triton X-100)

  • Affinity chromatography using Ni-NTA or Strep-Tactin resin

  • Tag removal using specific proteases

  • Size exclusion chromatography to separate monomers from oligomeric forms

  • Ion exchange chromatography for final polishing

Activity Preservation:

  • Include zinc ions (10-50 μM ZnCl2) in all buffers

  • Add ATP or non-hydrolyzable ATP analogs to stabilize the AAA domain

  • Maintain detergent above critical micelle concentration throughout purification

This protocol would need to be optimized specifically for AtFtsH10 based on empirical testing.

What techniques are most effective for studying AtFtsH10 protein-protein interactions in mitochondria?

Several complementary techniques can be employed to study AtFtsH10 protein-protein interactions in mitochondria:

In vivo approaches:

  • Co-immunoprecipitation (Co-IP): Using antibodies against FtsH proteins to pull down interacting partners. The search results mention antibodies available against FtsH proteases that could be used for this purpose .

  • Bimolecular Fluorescence Complementation (BiFC): By tagging potential interacting proteins with split fluorescent protein halves and observing reconstitution of fluorescence when interaction occurs.

  • Proximity-dependent biotin identification (BioID): Fusing AtFtsH10 to a biotin ligase to biotinylate proteins in close proximity, followed by streptavidin pulldown and mass spectrometry.

In vitro approaches:

  • Pull-down assays: Using purified recombinant AtFtsH10 as bait to capture interacting partners from mitochondrial extracts.

  • Surface Plasmon Resonance (SPR): To measure binding kinetics between AtFtsH10 and potential partners like AtFtsH3 or prohibitins.

  • Native gel electrophoresis: To preserve and analyze intact complexes containing AtFtsH10.

Structural approaches:

  • Cryo-electron microscopy: For structural characterization of AtFtsH10-containing complexes.

  • Crosslinking mass spectrometry: To identify interaction interfaces between AtFtsH10 and its partners.

The search results indicate that AtFtsH10 forms complexes with AtFtsH3 and prohibitins , and similar approaches could be used to identify additional interaction partners.

How can researchers accurately measure changes in AtFtsH10 expression and activity?

To accurately measure changes in AtFtsH10 expression and activity, researchers can employ the following techniques:

Transcript level measurement:

  • Quantitative RT-PCR (qRT-PCR): The search results mention using housekeeping genes (ubiquitin and actin) for normalization when measuring FtsH transcript levels .

  • RNA sequencing (RNA-seq): For genome-wide transcriptional analysis and comparison of AtFtsH10 expression under different conditions.

Protein level measurement:

  • Western blotting: Using specific antibodies against AtFtsH10. The search results mention antibodies available against FtsH proteins .

  • Quantitative proteomics: Using labeled (SILAC, TMT) or label-free approaches to measure relative or absolute AtFtsH10 protein levels.

Translation efficiency:

  • Polysome profiling: As described in the search results, this technique was used to demonstrate increased association of AtFtsH10 transcripts with polysomes in ftsh3 mutants .

  • Ribosome profiling: For genome-wide analysis of translation efficiency.

Activity measurement:

  • In vitro protease assays: Using purified recombinant AtFtsH10 and fluorogenic peptide substrates to measure proteolytic activity.

  • ATP hydrolysis assays: To measure the ATPase activity associated with AtFtsH10.

  • Substrate degradation assays: Using known or candidate substrates and monitoring their degradation in isolated mitochondria with varying levels of AtFtsH10.

By combining these approaches, researchers can comprehensively assess changes in AtFtsH10 expression and activity under different experimental conditions or in different genetic backgrounds.

What genetic modification approaches are most suitable for studying AtFtsH10 function?

Based on the search results and general approaches in plant molecular biology, several genetic modification strategies are suitable for studying AtFtsH10 function:

Loss-of-function approaches:

Gain-of-function approaches:

  • Overexpression: Using strong constitutive promoters (e.g., 35S) or inducible systems to increase AtFtsH10 levels.

  • Structure-based mutations: Introducing specific mutations to alter activity, substrate specificity, or protein interactions.

Complementation strategies:

  • Cross-species complementation: Testing if AtFtsH10 can functionally replace FtsH proteins in other organisms.

  • Domain swapping: Creating chimeric proteins with domains from other FtsH family members to identify functional regions.

Expression reporters:

  • Promoter-reporter fusions: To study transcriptional regulation of AtFtsH10.

  • Protein-tag fusions: For visualization of AtFtsH10 localization and dynamics.

The choice of approach should consider the viability of complete AtFtsH10 knockout and the specific aspects of AtFtsH10 function being investigated.

How should researchers interpret changes in AtFtsH10 levels in different Arabidopsis mutants?

When analyzing changes in AtFtsH10 levels across different Arabidopsis mutants, researchers should consider multiple layers of interpretation:

Compensatory mechanisms: The increase in AtFtsH10 levels observed in ftsh3 mutants suggests a compensatory mechanism . When interpreting similar patterns in other mutants, researchers should consider whether changes represent:

  • Direct regulatory relationships between the mutated gene and AtFtsH10

  • Indirect effects due to altered mitochondrial function

  • Compensatory adaptations to maintain minimal proteolytic capacity

Translation vs. transcription regulation: The search results indicate that AtFtsH10 upregulation in ftsh3 mutants occurs at the translational rather than transcriptional level . Researchers should therefore examine:

Regulatory LevelMeasurement TechniqueInterpretation
TranscriptionqRT-PCR, RNA-seqChanges in mRNA synthesis or stability
TranslationPolysome profiling, Ribosome profilingChanges in protein synthesis efficiency
Post-translationWestern blot, ProteomicsChanges in protein stability or modification

Complex formation changes: Alterations in AtFtsH10 levels may reflect changes in its incorporation into protein complexes. The search results indicate that AtFtsH10 forms both homo-oligomeric and hetero-oligomeric complexes . Researchers should use native gel electrophoresis or size-exclusion chromatography to determine how mutations affect complex formation.

Functional redundancy: When interpreting phenotypes of mutants with altered AtFtsH10 levels, researchers should consider potential redundancy with other FtsH family members, which may mask phenotypic effects.

What statistical approaches are most appropriate for analyzing AtFtsH10 expression data?

When analyzing AtFtsH10 expression data, researchers should employ appropriate statistical methods depending on the experimental design and data characteristics:

For comparing expression across genotypes or treatments:

  • Student's t-test: For comparing two groups (e.g., wild-type vs. mutant).

  • ANOVA followed by post-hoc tests: For comparing multiple groups (e.g., wild-type vs. multiple mutants or treatments).

  • Non-parametric alternatives: Such as Mann-Whitney U test or Kruskal-Wallis test if data does not follow normal distribution.

For time-course experiments:

  • Repeated measures ANOVA: When measuring the same samples at multiple time points.

  • Mixed-effect models: To account for both fixed effects (genotype, treatment) and random effects (individual plant variation).

For multivariate analyses:

  • Principal Component Analysis (PCA): To identify patterns when measuring multiple variables (e.g., expression of multiple FtsH family members).

  • Clustering analyses: To identify groups of genes with similar expression patterns.

For polysome profiling data:

  • Polysome-to-monosome ratio analysis: To quantify translation efficiency.

  • Area-under-curve calculations: For quantifying transcript abundance in different polysome fractions.

The search results mention using "BioRad CFX Manager 3.1 software" for analyzing qRT-PCR data , which typically implements appropriate statistical methods for gene expression analysis.

Researchers should always:

  • Include appropriate biological and technical replicates (minimum n=3)

  • Report both effect sizes and p-values

  • Apply multiple testing corrections when analyzing multiple genes simultaneously

  • Validate key findings using independent experimental approaches

What are the most promising directions for future research on AtFtsH10?

Based on the current knowledge gaps identified in the search results, several promising research directions for AtFtsH10 include:

  • Substrate identification: Comprehensive identification of AtFtsH10 substrates using techniques such as proximity labeling coupled with proteomics, or degradomics approaches to identify proteins with altered stability in ftsh10 mutants.

  • Stress response roles: Investigation of AtFtsH10's role in mitochondrial responses to various stresses, similar to the roles described for FtsH proteases in cyanobacteria . This could involve analyzing ftsh10 mutants under different stress conditions and identifying condition-specific changes in AtFtsH10 activity.

  • Regulation mechanisms: Elucidation of the molecular mechanisms underlying the translational upregulation of AtFtsH10 in ftsh3 mutants , which could reveal novel regulatory pathways controlling mitochondrial protein quality control.

  • Structure-function relationships: Structural studies of AtFtsH10 alone and in complex with interaction partners, which could provide insights into substrate recognition and processing mechanisms.

  • Cross-talk with other organelles: Investigation of potential communication between mitochondrial AtFtsH10 and quality control systems in other cellular compartments, such as chloroplasts, which also contain FtsH proteases.

  • Evolutionary adaptation: Comparative studies of FtsH10 across different plant species to understand how this protease has adapted to different environmental niches and metabolic demands.

  • Therapeutic applications: Exploration of whether targeting plant mitochondrial proteases like AtFtsH10 could lead to improved stress resistance or other agriculturally valuable traits.

Each of these directions would contribute to a more comprehensive understanding of AtFtsH10's role in plant mitochondrial biology and potentially reveal new strategies for improving plant stress resistance.

How might advanced technologies like CRISPR gene editing enhance our understanding of AtFtsH10 function?

CRISPR/Cas9 gene editing technologies offer several advantages for studying AtFtsH10 function that were not available with traditional genetic approaches:

  • Precise point mutations: CRISPR enables the introduction of specific mutations in functional domains of AtFtsH10, such as:

    • The HEXXH motif in the metalloprotease domain

    • The Walker A and B motifs in the AAA domain

    • Specific residues involved in protein-protein interactions

    This allows for separation of different functions (e.g., ATPase vs. protease activity) without complete protein elimination.

  • Conditional knockouts: If complete AtFtsH10 knockout is lethal, CRISPR can be used to create conditional systems such as:

    • Inducible knockout systems

    • Tissue-specific knockout systems

    • Developmental stage-specific knockout systems

    This allows for studying AtFtsH10 function in specific contexts while maintaining viability.

  • Tagged endogenous protein: CRISPR can be used to add tags (fluorescent proteins, epitope tags, proximity labeling enzymes) to the endogenous AtFtsH10 gene, ensuring that the tagged protein is expressed at physiological levels and under native regulation.

  • Promoter modifications: CRISPR can be used to modify the endogenous AtFtsH10 promoter to alter its expression pattern or responsiveness to specific signals.

  • Multiplexed editing: CRISPR allows for simultaneous editing of multiple genes, enabling the creation of double or triple mutants in the FtsH family to address functional redundancy.

  • High-throughput screening: CRISPR screens can be used to identify genetic interactions with AtFtsH10, revealing functional relationships with other genes.

By utilizing these advanced gene editing capabilities, researchers can address previously intractable questions about AtFtsH10 function and regulation, potentially leading to breakthroughs in understanding its role in plant mitochondrial biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.