Recombinant Arabidopsis thaliana ATP-dependent zinc metalloprotease FTSH 11, chloroplastic/mitochondrial (FTSH11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FTSH11; At5g53170; MFH8.11; ATP-dependent zinc metalloprotease FTSH 11, chloroplastic/mitochondrial; AtFTSH11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
64-806
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FTSH11
Target Protein Sequence
QDNVASDSDFIPKDSAFEVTDSAESNRLVSDTEVSELETNDRFVGGEETKSGGEEAEVSN GVTEGKEEDQKKSKFRIVVLMMALWAAIKRAIEKVMEWEWLSWWPFSRQEKRLEKLIAEA DANPKDAALQGALLAELNKHIPEAVVQRFEQREHTVDSRGVAEYIRALVITNAISEYLPD EQTGKPSSLPALLQELKHRASGNMDESFVNPGISEKQPLHVTMVNPKVSNKSRFAQELVS TILFTVAVGLVWIMGAAALQKYIGSLGGIGTSGVGSSSSYSPKELNKEITPEKNVKTFKD VKGCDDAKQELEEVVEYLKNPSKFTRLGGKLPKGILLTGAPGTGKTLLAKAIAGEAGVPF FYRAGSEFEEMFVGVGARRVRSLFQAAKKKAPCIIFIDEIDAVGSTRKQWEGHTKKTLHQ LLVEMDGFEQNEGIIVMAATNLPDILDPALTRPGRFDRHIVVPSPDVRGREEILELYLQG KPMSEDVDVKAIARGTPGFNGADLANLVNIAAIKAAVEGAEKLSSEQLEFAKDRIVMGTE RKTMFVSEDSKKLTAYHESGHAIVALNTKGAHPIHKATIMPRGSALGMVTQLPSNDETSV SKRQLLARLDVCMGGRVAEELIFGLDHITTGASSDLSQATELAQYMVSSCGMSEAIGPVH IKERPSSDMQSRIDAEVVKLLREAYERVKSLLKRHEKQLHTLANALLEYETLTAEDIKRI LLPKQEGEKFEEQQQEEGDLVLA
Uniprot No.

Target Background

Function
This protein is a probable ATP-dependent zinc metallopeptidase involved in the assembly and/or stability of mitochondrial respiratory complexes I and V. It plays a role in thermotolerance but not in high-light stress resistance or in the assembly/stability of complexes I and V of the mitochondrial oxidative phosphorylation system.
Gene References Into Functions
  1. AtFtsH11 is essential for normal photosynthetic function under moderately elevated temperatures. Its associated network plays critical roles in maintaining the thermostability and structural integrity of both photosystems under these conditions. PMID: 29320985
  2. FtsH11 is crucial for chloroplast structure and function during prolonged photoperiods. PMID: 27479913
  3. The *A. thaliana* FtsH11-encoded protease directly contributes to thermotolerance. PMID: 16972866
Database Links

KEGG: ath:AT5G53170

STRING: 3702.AT5G53170.1

UniGene: At.7145

Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Intermembrane side. Plastid, chloroplast thylakoid membrane; Single-pass membrane protein; Stromal side.

Q&A

What is the cellular localization of FTSH11 in Arabidopsis thaliana?

FTSH11 has been primarily localized to the chloroplast envelope through multiple experimental approaches. While initial studies suggested dual targeting to both chloroplasts and mitochondria, more recent evidence from immunoblot analyses of leaf extracts, isolated organelles, and sub-fractionated chloroplast membranes has predominantly localized FTSH11 to chloroplast envelopes . The question of mitochondrial localization remains somewhat ambiguous, as some studies could not detect FTSH11 in purified mitochondria, leaving the dual-targeting hypothesis unresolved .

For reliable localization studies, researchers should employ multiple techniques including:

  • Subcellular fractionation followed by immunoblotting

  • Fluorescent protein tagging with confocal microscopy

  • Immunogold electron microscopy for high-resolution localization

  • Proteomic analysis of purified organelles

What is the primary physiological role of FTSH11 in plants?

FTSH11 plays a critical role in thermotolerance in Arabidopsis thaliana. Unlike other FTSH proteases that primarily alleviate light stress, FTSH11 specifically contributes to the plant's ability to withstand elevated temperatures . Knockout mutants of FTSH11 demonstrate:

  • Susceptibility to moderately elevated temperatures (>30°C)

  • Defects in acquired thermotolerance after pre-conditioning at 38°C

  • Arrested growth and development when exposed to temperatures permissive for wild-type plants

  • Reduced photosynthetic capability at elevated temperatures

Additionally, FTSH11 is essential for adaptation to continuous light, as ftsh11 knockout mutants develop chlorosis when shifted to continuous light conditions .

How does FTSH11 differ from other FTSH proteases in Arabidopsis?

The Arabidopsis genome contains 12 genes encoding FTSH proteases, with FTSH11 displaying several distinctive characteristics compared to other family members:

FeatureFTSH11Other FTSH Proteases (e.g., FTSH1,2,5,8)
LocalizationPrimarily chloroplast envelopePredominantly thylakoid membrane
Primary functionThermotoleranceLight stress alleviation
Stress responseHeat stressPhotodamage
SubstratesEnvelope proteins (TIC40, PAPST2, FAP1, HSP70)Thylakoid proteins (D1 protein, LHCII)
Mutant phenotypeThermosensitive; chlorosis in continuous lightVariegated leaves; light sensitivity

Unlike most characterized FTSH proteins involved in degrading unassembled thylakoid membrane proteins and photodamaged photosystem II D1 protein, FTSH11 appears to have a distinct role in chloroplast envelope quality control during heat stress .

What are effective methods to study FTSH11 function?

To effectively study FTSH11 function, researchers should consider the following methodological approaches:

Genetic approaches:

  • Generate knockout or knockdown mutants using T-DNA insertion lines or CRISPR-Cas9

  • Complement mutant lines with wild-type or site-directed mutant variants

  • Create transgenic lines expressing tagged versions (HA, GFP) under native promoters

Functional assays:

  • Thermotolerance assays: Expose plants to moderate heat stress (30°C) or pre-condition at 38°C before subjecting to higher temperatures

  • Continuous light exposure experiments: Monitor chloroplast structure and function

  • Photosynthetic measurements: Assess chlorophyll content (chl a/b ratios) and PSII quantum yield

A particularly informative approach is the complementation of FTSH11 knockout mutants with either proteolytically active or inactive variants, which demonstrated that the proteolytic activity is essential for thermotolerance .

How can potential FTSH11 substrates be identified and validated?

Identifying and validating FTSH11 substrates requires a multi-faceted approach:

Identification strategies:

  • Affinity purification with proteolytically inactive FTSH11 (trap mutant approach) followed by mass spectrometry

  • Comparative proteomic analysis between wild-type and knockout plants under normal and stress conditions

  • Yeast two-hybrid or split-ubiquitin screens for membrane protein interactions

Validation methods:

  • In vitro degradation assays with purified components

  • Protein stability assays comparing substrate half-life in wild-type vs. ftsh11 mutants

  • Co-immunoprecipitation to confirm physical interaction

  • Genetic epistasis analysis

Research has identified several potential FTSH11 substrates using these approaches, including TIC40, the nucleotide antiporter PAPST2, the fatty acid binding protein FAP1, and the chaperone HSP70, all of which were found trapped in affinity enrichment assays with proteolytically inactive FTSH11 .

What experimental conditions optimize the study of FTSH11's role in thermotolerance?

For robust analysis of FTSH11's role in thermotolerance, the following experimental conditions are recommended:

Temperature regimes:

  • Standard growth: 20-22°C, 16/8 hour light/dark cycle

  • Moderate heat stress: 30°C continuous

  • Acquired thermotolerance protocol: Pre-condition at 38°C for 1.5 hours, recover at 22°C for 2 hours, then expose to 45°C

Light conditions:

  • Normal photoperiod: 16/8 hour light/dark cycle

  • Continuous light: Particularly revealing for FTSH11 function as mutants develop chlorosis

  • Light intensity: 100-120 μmol photons m⁻² s⁻¹ (moderate)

Developmental stages to examine:

  • Seedling stage (7-10 days)

  • Young vegetative stage (3-4 weeks)

  • Mature plants (6 weeks)

Key measurements:

  • Growth rate and morphological changes

  • Photosynthetic parameters (Fv/Fm, NPQ, state transitions)

  • Chlorophyll content and chloroplast ultrastructure

  • Proteomic changes in organelles

Studies have shown that ftsh11 mutants exhibit arrested growth and development at all stages when exposed to temperatures above 30°C, which are permissive conditions for wild-type plants .

What is known about FTSH11's interaction with chloroplast proteins?

Affinity purification followed by mass spectrometry has revealed important protein interactions of FTSH11:

Key interaction partners:

  • Components of the CPN60 chaperonin complex, suggesting coordination between protein folding and degradation

  • Proteins involved in chloroplast envelope function and transport

Potential substrates identified through multiple experimental approaches:

  • TIC40: Component of the TIC (Translocon at the Inner Chloroplast membrane) complex

  • PAPST2: Nucleotide antiporter located in the chloroplast envelope and mitochondria

  • FAP1: Fatty acid binding protein

  • HSP70: Stromal chaperone

These proteins were identified by two independent experimental approaches: they were found trapped in proteolytically inactive FTSH11 and showed altered accumulation in FTSH11 knockout mutants .

How does FTSH11 contribute to chloroplast proteostasis during heat stress?

FTSH11 appears to be a critical component of chloroplast proteostasis during heat stress through the following mechanisms:

  • Quality control of envelope proteins:

    • Degradation of damaged or misfolded proteins in the chloroplast envelope

    • Regulation of key transporters and translocons

  • Coordination with chaperone systems:

    • Interaction with CPN60 complex suggests coordination between protein folding and degradation

    • Upregulation of stromal chaperones (HSP70, CLPB3) in FTSH11 mutants indicates compensatory mechanisms

  • Maintenance of photosynthetic capacity:

    • Prevents accumulation of damaged proteins that could impair photosynthesis during heat stress

    • Helps maintain proper chloroplast structure and function during elevated temperatures

In FTSH11 knockout mutants, the impairment of this proteostasis network leads to upregulation of stromal chaperones such as two different HSP70s and CLPB3, as well as components of the CLP protease system (CLPP4, CLPT1, CLPT2), suggesting compensatory mechanisms attempting to maintain proteostasis .

What is the mechanism by which FTSH11 affects photosynthetic capability during heat stress?

The impact of FTSH11 on photosynthetic capability during heat stress involves multiple mechanisms:

Direct effects:

  • Maintenance of chloroplast envelope integrity during heat stress

  • Regulation of chloroplast transporters (e.g., PAPST2) that affect metabolite exchange between chloroplast and cytosol

  • Possible indirect effects on thylakoid membrane organization

Physiological changes in ftsh11 mutants during heat stress:

  • Reduced chlorophyll content and altered chl a/b ratios

  • Decreased PSII quantum yield

  • Drastic changes in chloroplast morphology

  • Reduced non-photochemical quenching (NPQ)

  • Altered balance between photosystem I and photosystem II

Studies have shown that at 30°C, the amount of photosystem I decreases relative to photosystem II in ftsh11 mutants, accompanied by a drop in non-photochemical quenching . Additionally, proteomic analysis revealed upregulation of proteins involved in chlorophyll biosynthesis (CHLH and DVR) in the mutant at elevated temperatures, consistent with the pale phenotype observed .

How can contradictions regarding FTSH11 dual localization be resolved?

The question of FTSH11's dual targeting to both chloroplasts and mitochondria shows inconsistencies in the literature that can be addressed through several methodological approaches:

Experimental strategies to resolve localization conflicts:

  • Improved organelle purification:

    • Use density gradient centrifugation with multiple steps to ensure highly purified organelle fractions

    • Rigorously test for cross-contamination using compartment-specific markers

  • Tissue- and development-specific analysis:

    • Examine different tissues and developmental stages as localization may vary

    • Analyze under different stress conditions, as targeting might be stress-responsive

  • Advanced microscopy techniques:

    • Super-resolution microscopy with specific antibodies

    • Live-cell imaging with organelle-specific markers and tagged FTSH11

  • Targeting sequence analysis:

    • In vitro import assays with isolated mitochondria and chloroplasts

    • Mutagenesis of predicted targeting sequences to identify essential targeting elements

The current evidence shows stronger support for chloroplast envelope localization, with studies reporting inability to detect FTSH11 in purified mitochondria , contradicting earlier reports of mitochondrial localization . This highlights the importance of using multiple, complementary approaches to resolve such contradictions.

What are the comparative dynamics of FTSH11 function across plant species?

Exploring FTSH11 function across different plant species can provide valuable evolutionary insights:

Research approach recommendations:

  • Comparative genomic analysis of FTSH11 orthologs in plants with varying thermotolerance

  • Expression studies of FTSH11 orthologs under heat stress in diverse species

  • Cross-species complementation studies using FTSH11 from thermotolerant and thermosensitive species

  • Analysis of FTSH11 substrate conservation across plant lineages

Given that bacterial and yeast FtsH proteases have established roles in thermotolerance, whereas FTSH11 represents the first plant FtsH shown to have this function , evolutionary analyses could reveal how this function developed or was conserved during plant evolution.

How does FTSH11 integrate into broader stress response networks?

Understanding FTSH11's role within broader stress response networks requires integrated experimental approaches:

Key research directions:

  • Transcriptional regulation:

    • Analysis of promoter elements and transcription factors controlling FTSH11 expression

    • Chromatin immunoprecipitation to identify transcriptional regulators

  • Signaling pathway integration:

    • Investigation of how FTSH11 activity is regulated by stress signaling cascades

    • Possible post-translational modifications affecting FTSH11 activity during stress

  • Metabolic impact:

    • Metabolomic profiling of wild-type vs. ftsh11 mutants under normal and stress conditions

    • Analysis of how FTSH11-mediated protein turnover affects metabolic adjustments during stress

  • Cross-talk between stress responses:

    • Examination of FTSH11 function under combined stresses (e.g., heat+light, heat+drought)

    • Investigation of potential trade-offs between different stress adaptations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.