Recombinant Arabidopsis thaliana ATP-dependent zinc metalloprotease FTSH 2, chloroplastic (FTSH2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
FTSH2; VAR2; At2g30950; F7F1.16; ATP-dependent zinc metalloprotease FTSH 2, chloroplastic; AtFTSH2; Protein VARIEGATED 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
83-695
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FTSH2
Target Protein Sequence
DEQGVSSSRMSYSRFLEYLDKDRVNKVDLYENGTIAIVEAVSPELGNRVERVRVQLPGLS QELLQKLRAKNIDFAAHNAQEDQGSVLFNLIGNLAFPALLIGGLFLLSRRSGGGMGGPGG PGNPLQFGQSKAKFQMEPNTGVTFDDVAGVDEAKQDFMEVVEFLKKPERFTAVGAKIPKG VLLIGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCI VFVDEIDAVGRQRGTGIGGGNDEREQTLNQLLTEMDGFEGNTGVIVVAATNRADILDSAL LRPGRFDRQVSVDVPDVKGRTDILKVHAGNKKFDNDVSLEIIAMRTPGFSGADLANLLNE AAILAGRRARTSISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAVCGTLTPGH DAVQKVTLIPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEIIFGDSEVTTG AVGDLQQITGLARQMVTTFGMSDIGPWSLMDSSAQSDVIMRMMARNSMSEKLAEDIDSAV KKLSDSAYEIALSHIKNNREAMDKLVEVLLEKETIGGDEFRAILSEFTEIPPENRVPSST TTTPASAPTPAAV
Uniprot No.

Target Background

Function

This protein is part of a complex functioning as an ATP-dependent zinc metallopeptidase. It plays a crucial role in thylakoid formation and the removal of damaged D1 protein in photosystem II, preventing cell death under high-light conditions. However, it does not appear to be involved in thermotolerance.

Gene References Into Functions
  1. Thylakoid membrane-bound FtsH5 and FtsH2 are dual-function proteins involved in maintaining photosynthetic complexes. PMID: 27208291
  2. The initiation of (1)O2 signaling in grana margins relies on EX1 and the ATP-dependent zinc metalloprotease FtsH. Since FtsH also cleaves the D1 protein during damaged PSII disassembly, EX1- and (1)O2-mediated signaling appears to be spatially and functionally linked to PSII repair. PMID: 27303039
  3. SVR10 and BPG2 are functionally related to VAR2, likely through their roles in regulating chloroplast protein homeostasis. PMID: 26435530
  4. This reference provides an update on IM, VAR2, and the functions of PTOX and AtFtsH2. PMID: 23703455
  5. Disruptions in specific aspects of chloroplast translation, rather than general impairment, suppress var2 variegation, indicating complex genetic interactions in chloroplast development. PMID: 23721655
  6. This study demonstrates in vivo cooperative D1 degradation, where Deg cleavage assists FtsH processive degradation under photoinhibitory conditions. PMID: 22698923
  7. To obtain structural information on potential complexes, Arabidopsis FtsH2 (type B) and FtsH5 (type A) were modeled. PMID: 22558304
  8. Chloroplastic N-terminal methionine excision (cNME) acts upstream of the FtsH protease complex. Developmental defects and increased photoinhibition sensitivity associated with the ftsh2 mutation were eliminated upon cNME inhibition. PMID: 22010036
  9. In Arabidopsis thaliana, chloroplastic ATP-dependent FtsH family proteases (especially FtsH2) are involved in chloroplast and whole-plant maintenance under both stress and non-stress conditions. PMID: 21735825
  10. The Tat pathway integrates FtsH2 into thylakoids. PMID: 21214651
  11. These findings reinforce the strong genetic link between VAR2 and chloroplast translation, highlighting a critical role for SVR3 and potentially aspects of chloroplast translation in plant responses to chilling stress. PMID: 21187014
  12. The effect of FtsHs on D1 degradation was investigated in Arabidopsis thaliana mutants lacking FtsH2 (yellow variegated2 [var2]) or FtsH5 (var1). PMID: 19767385
  13. Results indicate that the conserved Gly-Ala-Asp motif plays a key role in FtsH activity, and characterization of var2 alleles helps identify physiologically important FtsH domains. PMID: 15803409
  14. A model explaining var2 variegation proposes that threshold levels of FtsH complexes are necessary for green sector formation. PMID: 16449381
  15. White sectors in var2 consist of viable cells with plastids arrested in thylakoid formation. PMID: 17449646
  16. These results indicate that photo-oxidative stress from excess light regulates respiratory gene expression and modulates respiratory properties, particularly AOX upregulation. PMID: 18296449
  17. Data show that var2-mediated leaf variegation in Arabidopsis can be suppressed by mutations in SUPPRESSOR OF VARIEGATIONS. PMID: 18599582
  18. Chloroplast development enhanced by ectopic GPA1 expression depends on FtsH2. PMID: 19228339
Database Links

KEGG: ath:AT2G30950

STRING: 3702.AT2G30950.1

UniGene: At.22024

Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein; Stromal side.
Tissue Specificity
Expressed in cotyledons, cauline and rosette leaves, stems, sepals, flovers and siliques. Very low in roots.

Q&A

What is FtsH2 and where is it localized in Arabidopsis thaliana?

FtsH2 (also known as VAR2) is an ATP-dependent zinc metalloprotease that forms part of the thylakoid membrane-bound FtsH protease complex in chloroplasts. In Arabidopsis, the FtsH complex exists as heterohexamers composed of type A subunits (FtsH1 and FtsH5) and type B subunits (FtsH2 and FtsH8), with both the ATPase domain and protease domain oriented toward the stromal side of the thylakoid membrane . The protein is integrated into the thylakoid membrane specifically via the Tat (twin-Arg translocation) pathway, which differs from the Sec (secretion) pathway used by type A subunits . FtsH2 has a molecular weight of approximately 65.6 kDa and is found predominantly in the grana margin of chloroplast thylakoid membranes, where PSII repair processes occur .

What phenotypes are associated with FtsH2 mutations in Arabidopsis?

Mutations in the FtsH2 gene result in the yellow variegated2 (var2) phenotype, characterized by distinctive leaf variegation with sectors of normal green tissue interspersed with white or yellow sectors that lack properly developed chloroplasts . The var2 mutant shows a more severe leaf variegation phenotype compared to the var1 mutant (deficient in FtsH5) . This variegation pattern typically decreases during plant development. The variegated phenotype reflects the essential role of FtsH2 in chloroplast development and thylakoid membrane biogenesis . Additionally, var2 mutants exhibit increased sensitivity to high-light stress, demonstrating accelerated photoinhibition due to compromised PSII repair cycles .

How does FtsH2 function with other FtsH subunits in the thylakoid membrane?

FtsH2 operates within a heterohexameric complex together with other FtsH subunits. Type B subunits (FtsH2 and FtsH8) work coordinately with type A subunits (FtsH1 and FtsH5) to form functional proteolytic complexes . Although there is high sequence similarity between type A and type B subunits, they are not functionally identical and are integrated into thylakoid membranes via different pathways . The subunits show differential abundance, with FtsH2 and FtsH5 being more abundant than FtsH8 and FtsH1, which explains why mutations in the more abundant subunits produce stronger phenotypes .

When FtsH2 is absent, remaining FtsH8 subunits can partially compensate for its function due to their high homology, but this compensation is insufficient to maintain normal chloroplast development in all cells, leading to the characteristic variegated pattern . The total FtsH protein level is thought to define a threshold that determines the fate of plastids during leaf development, known as the threshold model .

What methods are commonly used to detect and quantify FtsH2 in plant samples?

The primary method for detecting FtsH2 in plant samples is immunoblot analysis (Western blot) using FtsH2-specific antibodies. Commercial polyclonal antibodies against recombinant Arabidopsis thaliana FtsH2 are available, with a recommended dilution of 1:5000 for Western blot applications . These antibodies typically recognize both FtsH2 and FtsH8 proteins due to their high sequence homology .

For immunoblot detection:

  • Extract and isolate thylakoid membrane proteins from plant tissue

  • Separate proteins using SDS-PAGE

  • Transfer proteins to a membrane

  • Incubate with anti-FtsH2 antibodies

  • Visualize using appropriate secondary antibodies and detection systems

When interpreting results, researchers should be aware that detected signals in var2 mutants are often attributed to the homologous FtsH8 protein. For accurate quantification, comparisons should be made with wild-type samples and appropriate controls .

How does FtsH2 participate in chloroplast retrograde signaling pathways?

FtsH2 plays a critical role in singlet oxygen (¹O₂)-triggered retrograde signaling through its interaction with EXECUTER1 (EX1). This signaling pathway represents a sophisticated communication system from chloroplasts to the nucleus in response to oxidative stress . The mechanism involves:

  • Upon singlet oxygen (¹O₂) generation in chloroplasts, FtsH2 mediates the proteolytic degradation of EX1 proteins

  • This degradation occurs specifically at the grana margin where FtsH2 and EX1 are co-localized

  • The proteolysis of EX1 is essential for triggering the subsequent signaling cascade

  • The process leads to the activation of Singlet Oxygen-Responsive Genes (SORGs)

Notably, inactivation of FtsH2 significantly compromises EX1 degradation and the concurrent ¹O₂-triggered programmed cell death (PCD) in Arabidopsis flu mutants. Research has revealed that chloroplasts may operate two distinct ¹O₂ signaling pathways: one operating in the grana core mediated by β-carotene, and another in the grana margin coordinated by EX1 and FtsH2 . The exact nature of the signaling molecule generated upon EX1 proteolysis remains to be elucidated, representing an important area for future research.

What is the significance of FtsH2 phosphorylation sites for protein function?

Phosphoproteomic studies have identified four phosphorylation sites in the mature FtsH2 protein: Ser-212, Thr-337, Ser-380, and Ser-393 . Site-directed mutagenesis experiments have revealed that these sites have differential impacts on FtsH2 function:

Phosphorylation SiteEffect of Alanine SubstitutionImpact on PhenotypeFtsH Accumulation
Ser-212Critical defectPersistent leaf variegationSignificantly reduced
Thr-337ToleratedRescues variegated phenotypeSimilar to wild-type
Ser-380ToleratedRescues variegated phenotypeSimilar to wild-type
Ser-393ToleratedRescues variegated phenotypeSimilar to wild-type

The most notable finding is that Ser-212 is particularly important for maintaining FtsH2 activity and stability . When this residue was mutated to alanine (var2 S212A), the variegated phenotype persisted and FtsH accumulation was considerably reduced to levels comparable to those in the original var2 mutant. This indicates that phosphorylation at Ser-212 likely plays a crucial regulatory role in FtsH2 function, possibly affecting its integration into the thylakoid membrane, complex assembly, or proteolytic activity .

How does FtsH2 participate in the PSII repair cycle?

FtsH2 is an essential component of the Photosystem II (PSII) repair cycle, a fundamental process conserved across photosynthetic organisms to mitigate photoinhibition . The specific roles of FtsH2 in this cycle include:

  • Recognition and proteolysis of photodamaged D1 proteins in PSII reaction centers

  • Facilitating the removal of damaged proteins to allow insertion of newly synthesized D1

  • Coordinating with other repair mechanisms to maintain PSII function under high light stress

The importance of FtsH2 in the PSII repair cycle is demonstrated by the increased photosensitivity of var2 mutants, which show accelerated photoinhibition due to impaired removal of damaged D1 proteins . This photosensitivity highlights the critical role FtsH2 plays in protecting plants against high-light stress by maintaining functional PSII complexes.

Methodologically, researchers studying FtsH2's role in PSII repair typically employ:

  • Pulse-chase experiments with radiolabeled amino acids to track D1 protein turnover

  • High-light treatment assays to assess photoinhibition rates

  • Chlorophyll fluorescence measurements to evaluate PSII efficiency

  • Protein complex analysis using blue-native PAGE to monitor PSII assembly states

What genetic approaches have been used to identify FtsH2 functional networks?

Several genetic approaches have been utilized to elucidate FtsH2 functional networks, with suppressor screening being particularly informative:

  • Suppressor mutant screening: Taking advantage of the distinctive leaf variegation phenotype of var2, researchers have identified genetic modifiers including Suppressors of Variegation (SVR) and Enhancers of Variegation (EVR) .

  • Identification of suppressor loci: Key suppressor loci encode proteins involved in chloroplast translation, including:

    • Chloroplast Ribosomal Protein L24 (RPL24)

    • Chloroplast translation initiation factor IF3

    • Chloroplast translation elongation factor EF-Tu

  • Complementation studies: Transgenic approaches using site-directed mutagenesis of FtsH2 have demonstrated that not all catalytic sites are required for adequate thylakoid membrane development, suggesting FtsH2 may also function as a scaffold protein .

  • Protein-protein interaction studies: Yeast two-hybrid and pull-down experiments have identified novel interaction partners, such as FIP (FtsH5 Interacting Protein), a zinc-finger thylakoid-membrane protein involved in abiotic stress response .

These genetic studies have revealed that the balance between protein biosynthesis in chloroplasts and FtsH function is crucial for proper chloroplast development . The suppression of leaf variegation by reduced chloroplast translation suggests a compensatory mechanism that helps maintain this critical balance.

How do FtsH proteases coordinate thylakoid membrane-associated proteostasis?

FtsH proteases play central roles in coordinating thylakoid membrane-associated proteostasis through several interconnected mechanisms:

  • Protein quality control: FtsH2, as part of the thylakoid FtsH complex, recognizes and degrades misfolded or damaged proteins, preventing their toxic accumulation in the thylakoid membrane .

  • Coordination with protein insertion pathways: Recent research has revealed that chloroplast Signal Recognition Particle 54 (SRP54) coordinates with FtsH proteases to maintain thylakoid membrane-associated proteostasis . This partnership ensures proper insertion of membrane proteins while removing damaged components.

  • Developmental regulation: FtsH2 is essential for thylakoid membrane biogenesis, with var2 mutants showing collapse of thylakoid membranes during late stages of leaf development . This suggests that beyond its proteolytic function, FtsH2 may play a structural role in organizing thylakoid architecture.

  • Stress adaptation: FtsH2 functions in abiotic stress responses, with its activity modulated by interaction partners such as FIP. Knockdown of FIP makes plants more tolerant to abiotic stresses, indicating a regulatory connection between FtsH activity and stress adaptation mechanisms .

  • Balance with protein synthesis: The proteolytic activity of FtsH needs to be balanced with chloroplast protein synthesis rates. This balance is crucial during leaf development and defines the fate of plastids, as demonstrated by the suppression of variegation in var2 through reduced chloroplast translation .

For researchers investigating these mechanisms, approaches combining genetic manipulation, proteomics, and high-resolution microscopy have proven most effective in unraveling the complex interplay between FtsH proteases and other components of the chloroplast proteostasis network.

What are the critical unanswered questions about FtsH2 function in singlet oxygen signaling?

Several fundamental questions remain unanswered regarding FtsH2's role in singlet oxygen (¹O₂) signaling, presenting opportunities for future research:

  • What is the specific source of singlet oxygen in the grana margin where FtsH2 and EX1 are co-localized?

  • What is the precise mechanism by which EX1 senses and mediates retrograde signaling in coordination with FtsH2?

  • What is the genuine signaling molecule that is generated upon EX1 proteolysis by FtsH2?

  • Why do plants maintain two distinctive ¹O₂-triggered retrograde signaling pathways (β-carotene-mediated in grana core and EX1-FtsH2-dependent in grana margin)?

Addressing these questions will require sophisticated approaches combining genetic engineering, real-time imaging of reactive oxygen species, proteomic analysis of FtsH2 substrates, and transcriptomic profiling of signaling outcomes under various conditions.

How can researchers effectively study FtsH2 function when complete knockout is lethal?

Complete loss of either type A or type B FtsH subunits leads to albino seedlings, indicating that thylakoid FtsH is essential for chloroplast development . This lethality presents methodological challenges for researchers. Effective approaches to circumvent this limitation include:

These approaches have already yielded valuable insights, such as the identification of critical phosphorylation sites and the recognition that not all catalytic sites are required for adequate thylakoid membrane development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.