Recombinant Arabidopsis thaliana ATP-dependent zinc metalloprotease FTSH 3, mitochondrial (FTSH3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
FTSH3; At2g29080; T9I4.16; ATP-dependent zinc metalloprotease FTSH 3, mitochondrial; AtFTSH3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
84-809
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FTSH3
Target Protein Sequence
SDEAPKKKNYENYFPKDKQEPKSDQKSEHKEGSEKNENENVGDMFMNRFQNLLIPLLALA VFFSTFSFGSGEQQQISFQEFKNKLLEPGLVDHIDVSNKSVAKVYVRSTPKDQQTTDVVH GNGNGIPAKRTGGQYKYYFNIGSVDSFEEKLEEAQEALGVDRHEYVPVTYVSEMVWYQEF MRFAPTLLLLGTLIYGARRMQGGLGVGGTGGKNGRGIFNIGKATITRADKHSKNKIYFKD VAGCDEAKQEIMEFVHFLKNPKKYEDLGAKIPKGALLVGPPGTGKTLLAKATAGESGVPF LSISGSDFMEMFVGVGPSRVRHLFQEARQAAPSIIFIDEIDAIGRARGRGGLGGNDERES TLNQLLVEMDGFGTTAGVVVLAGTNRPDILDKALLRPGRFDRQITIDKPDIKGRDQIFKI YLKKIKLDHEPSYYSQRLAALTPGFAGADIANVCNEAALIAARHEGATVTMAHFESAIDR VIGGLEKKNRVISKLERRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAALGFAQYVP NENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSDKV GLLSFPPRDDGYDFSKPYSNKTGAIIDEEVRDWVAKAYERTVELVEEHKVKVAEIAELLL EKEVLHQDDLLKILGERPFKSAEVTNYDRFKSGFEETEKDSAATPTVEPVVDDGAPPPFE PQVVPT
Uniprot No.

Target Background

Function
Probable ATP-dependent zinc metallopeptidase involved in the assembly and/or stabilization of mitochondrial oxidative phosphorylation complexes I and V.
Database Links

KEGG: ath:AT2G29080

STRING: 3702.AT2G29080.1

UniGene: At.24335

Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Q&A

What is FTSH3 and where is it localized in Arabidopsis thaliana?

FTSH3 is an ATP-dependent zinc metalloprotease that belongs to the FtsH family of proteases in Arabidopsis thaliana. It is exclusively localized to the mitochondria, specifically anchored in the inner mitochondrial membrane with its active side facing the matrix compartment . As part of a group of twelve FtsH proteins in Arabidopsis, FTSH3 is one of only three (including FTSH4 and FTSH10) that are specifically targeted to mitochondria, while FTSH11 is double-targeted to both mitochondria and chloroplasts . The localization of FTSH3 is critical for its function in mitochondrial protein quality control and bioenergetics.

How does FTSH3 differ from other FtsH proteases in Arabidopsis?

FTSH3 belongs to the m-AAA subgroup of FtsH proteases (matrix-facing) in Arabidopsis, distinguishing it from i-AAA proteases (intermembrane space-facing) like FTSH4. Unlike the chloroplast-targeted FtsH proteases (FTSH1, 2, 5-9, and 12) that form well-characterized thylakoid complexes, FTSH3 forms a distinct mitochondrial complex . FTSH3 is unique in its direct interaction with respiratory Complex I components, particularly the PSST subunit . While several FtsH proteases have inactive homologues (termed FtsHi), FTSH3 retains its proteolytic domain with the zinc-binding motif, making it catalytically active . Additionally, FTSH3 has a paralogous relationship with FTSH10 in the Arabidopsis genome, with which it shares high sequence similarity (>80%) .

What are the known protein interactions of FTSH3?

FTSH3 directly interacts with the PSST subunit of respiratory Complex I, as demonstrated through yeast two-hybrid (Y2H) assays using a proteolytically inactive form of FTSH3 (FTSH3 TRAP) . This interaction is specific, as mutations in either FTSH3 (P415L) or PSST (S70F) disrupt this binding . FTSH3 also forms heterocomplexes with FTSH10, another mitochondrial FtsH protease, which has been confirmed through Y2H experiments . Interestingly, while FTSH3 interacts with PSST, FTSH10 does not show direct interaction with this Complex I subunit, suggesting functional specialization between these paralogous proteases . These specific interactions are crucial for understanding FTSH3's role in mitochondrial protein quality control and respiratory complex assembly/disassembly.

How can researchers effectively generate and verify recombinant FTSH3 for in vitro studies?

For successful recombinant FTSH3 production, researchers should consider several critical methodological aspects. First, clone the FTSH3 gene (At3g02450) without its predicted mitochondrial targeting sequence (first 42-50 amino acids) to improve solubility in heterologous expression systems. Expressing FTSH3 in E. coli systems requires careful optimization of induction conditions (preferably low temperature, 16-18°C and low IPTG concentration, 0.1-0.5 mM) to prevent inclusion body formation . For verification of proteolytic activity, generate a catalytically inactive FTSH3 variant by mutating the conserved zinc-binding motif (HEXXH to AEXXH) as a negative control . Purification should employ a combination of immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography to obtain homogeneous protein. Functional verification requires demonstrating both ATPase activity (using malachite green assay) and proteolytic activity (using fluorescently labeled protein substrates). For interaction studies, surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) with purified PSST and other potential interaction partners will provide quantitative binding data to complement in vivo findings .

What phenotyping approaches are most informative for characterizing FTSH3 mutants?

Comprehensive phenotyping of FTSH3 mutants requires multi-scale analysis across different developmental stages and stress conditions. At the seedling stage, quantify germination rates and timing, especially under ABA treatment, as ftshi3-1(kd) shows altered ABA sensitivity and accumulation . For vegetative growth, measure rosette size, leaf morphology, chlorophyll content, and photosynthetic efficiency (Fv/Fm) under normal and stress conditions . Root phenotyping should include primary root length, lateral root number and density, and root hair development . Drought response characterization is particularly informative, including measurements of water loss rates, stomatal conductance, stomatal density and aperture size, and water-use efficiency . For molecular phenotyping, quantify expression of ABA-responsive genes (like DREB1A and DREB2A) and mitochondrial stress response markers during normal growth and stress conditions . Finally, analyze mitochondrial function through respiration measurements, ATP production capacity, and reactive oxygen species (ROS) generation in isolated mitochondria from various tissues and developmental stages.

How does FTSH3 specifically contribute to respiratory Complex I degradation and turnover?

FTSH3 facilitates Complex I degradation through a direct protein-protein interaction with PSST, a 20 kDa subunit located at the interface of the membrane and matrix module of Complex I . Recent findings demonstrate that FTSH3 specifically interacts with PSST using its ATPase function rather than its proteolytic activity, as shown with a proteolytically inactive form (FTSH3 TRAP) . The interaction is disrupted by specific mutations: P415L in FTSH3 (as in the rmb1 mutant) or S70F in PSST (as in the rmb2 mutant) .

To investigate this mechanism, researchers should employ a combination of approaches: (1) In vitro reconstitution assays using purified FTSH3 and isolated Complex I to directly observe the unfolding and degradation process; (2) Site-directed mutagenesis of key residues in both FTSH3 and PSST to map the interaction interface in detail; (3) Time-course proteomic analysis using stable isotope labeling (SILAC) to track the degradation rates of individual Complex I subunits in wild-type versus ftsh3 mutant plants; (4) Cryo-electron microscopy to visualize the structural basis of FTSH3-Complex I interactions; and (5) In vivo protein turnover assays using fluorescence timer proteins fused to Complex I subunits to monitor degradation kinetics in living plant cells .

What is the relationship between FTSH3 and drought tolerance in Arabidopsis?

The relationship between FTSH3 and drought tolerance represents an intriguing area of research with significant implications. The ftshi3-1(kd) mutant exhibits remarkable drought tolerance, surviving up to 20 days after the last irrigation while wild-type plants wilt after 12 days . This enhanced drought resistance is accompanied by reduced stomatal size and density, smaller stomatal aperture, lowered stomatal conductance, and increased intrinsic water-use efficiency (WUEi) . Additionally, ftshi3-1(kd) plants show overaccumulation of abscisic acid (ABA) and upregulation of ABA-responsive genes, particularly DREB1A .

For comprehensive investigation of this phenomenon, researchers should: (1) Perform detailed transcriptomic and metabolomic analyses comparing wild-type and ftsh3 mutants under well-watered and drought conditions; (2) Analyze the ABA biosynthesis pathway components to identify the specific step affected by FTSH3 deficiency; (3) Use chromatin immunoprecipitation (ChIP) to identify potential transcription factors linking mitochondrial function to drought response pathways; (4) Investigate cellular energy status (ATP/ADP ratio, NAD+/NADH) during drought stress progression; (5) Employ grafting experiments (shoot/root) to determine tissue-specific contributions to the drought-tolerant phenotype; and (6) Examine potential alterations in root architecture and osmolyte accumulation that might contribute to enhanced water acquisition under drought conditions .

How do FTSH3 and FTSH10 coordinate their functions in mitochondrial protein quality control?

FTSH3 and FTSH10 are paralogous mitochondrial proteases that can form heterocomplexes, yet appear to have distinct functions . Understanding their coordinated action requires sophisticated methodological approaches. The P415L mutation in FTSH3 disrupts interaction with PSST but does not affect FTSH3-FTSH10 heterocomplex formation, suggesting functional specialization within the complex .

To dissect this coordination, researchers should: (1) Generate and characterize ftsh3/ftsh10 double mutants to assess potential synthetic phenotypes beyond the single mutants; (2) Perform comparative interactome studies using BioID or proximity labeling to identify unique and shared protein substrates of each protease; (3) Develop an in vitro reconstitution system with purified FTSH3, FTSH10, and various substrate proteins to determine the specific contribution of each protease to substrate recognition, unfolding, and degradation; (4) Use quantitative proteomics to measure protein turnover rates in single and double mutants under normal and stress conditions; (5) Investigate whether phosphorylation or other post-translational modifications regulate the activity and substrate specificity of these proteases; and (6) Employ super-resolution microscopy to determine whether FTSH3 and FTSH10 show differential spatial distribution within the mitochondrial inner membrane, potentially indicating specialized microdomains for protein quality control .

What are the contradictions in FTSH3 research findings that need resolution?

Several important contradictions require resolution in FTSH3 research. First, there are discrepancies between phenotypes of different ftsh3 mutant alleles. While ftshi3-1(kd) (GK-555D09-021662) shows a persistent pale-green phenotype throughout its life cycle, other alleles like ftshi3-2 (GK-723C06_025364) and ftshi3 (FLAG_215F10) display only a pale-seedling phenotype that normalizes in mature plants . This suggests either allele-specific effects or the influence of genetic background differences that must be systematically investigated using complementation studies and multiple independent alleles.

Second, there is an apparent contradiction between FTSH3's presumed role as a protease and findings that its ATPase activity, rather than proteolytic function, appears critical for Complex I regulation . This challenges the canonical model of how FtsH proteases function and requires biochemical dissection of the relative contributions of these two enzymatic activities. Future studies should employ domain-swap experiments and structure-function analyses to determine how FTSH3's unique properties contribute to its specialized functions.

Finally, the connection between mitochondrial function and drought tolerance observed in ftsh3 mutants appears counterintuitive, as impaired mitochondrial function typically reduces stress resistance rather than enhancing it. Resolving this paradox will require integrative systems biology approaches combining transcriptomics, metabolomics, and detailed physiological analyses to uncover the signaling pathways linking mitochondrial dysfunction to enhanced ABA responses and drought adaptation.

What technological advances would accelerate FTSH3 research?

Technological advances in several areas would significantly accelerate FTSH3 research. First, cryo-electron microscopy of native mitochondrial membranes could provide structural insights into FTSH3-containing complexes in their native environment, potentially revealing interaction partners and regulatory mechanisms that are lost during biochemical purification. This approach could be complemented by in-cell NMR to study FTSH3 dynamics in living plants.

Second, the development of mitochondria-specific CRISPR-Cas9 systems for targeted mutagenesis would allow precise engineering of FTSH3 variants in planta without disrupting nuclear genes. This technology would facilitate the creation of domain-specific mutations and regulatory element modifications to dissect FTSH3 function with unprecedented precision.

Third, advanced metabolic flux analysis techniques using stable isotope labeling and mass spectrometry would allow researchers to track how FTSH3 mutations affect energy metabolism pathways and substrate utilization under various growth conditions and stresses. This would provide a dynamic view of FTSH3's impact on mitochondrial function beyond static protein abundance measurements.

Fourth, the application of spatial transcriptomics and single-cell proteomics to ftsh3 mutants would reveal tissue-specific and cell-type-specific consequences of FTSH3 dysfunction, potentially explaining the complex phenotypes observed in these plants. These technologies would be particularly valuable for understanding the differential effects on root and shoot development.

Finally, the development of in vivo sensors for mitochondrial protease activity would allow real-time monitoring of FTSH3 function in living plants, providing insights into its regulation during development and stress responses.

How might insights from FTSH3 research translate to agricultural applications?

Research on FTSH3 has significant potential for agricultural applications, particularly in developing drought-resistant crops. The enhanced drought tolerance observed in ftshi3-1(kd) mutants, which exhibit reduced stomatal density, smaller stomatal aperture, and increased water-use efficiency, provides a promising genetic target for crop improvement . Translating these findings to agriculture requires several research directions.

First, comparative genomics studies across crop species to identify FTSH3 orthologs and characterize their function in species like rice, wheat, and maize. This would establish whether the drought tolerance mechanism is conserved and potentially exploitable in major crops. Analysis has already shown that rice contains 9 FtsH genes compared to 12 in Arabidopsis, with conservation of mitochondrial FtsH proteases .

Second, field trials with ftsh3 mutants or plants with modified FTSH3 expression would be essential to determine whether the drought tolerance observed in laboratory conditions translates to agricultural settings. These trials should measure yield components under various water availability scenarios to assess potential trade-offs between stress tolerance and productivity.

Third, precision breeding approaches using CRISPR-Cas9 technology could introduce targeted modifications to FTSH3 orthologs in crops, potentially fine-tuning their function to enhance drought tolerance without severely compromising growth. This would require detailed structure-function analyses to identify specific modifications that enhance beneficial traits while minimizing negative pleiotropic effects.

Fourth, the development of molecular markers associated with optimal FTSH3 alleles could facilitate marker-assisted selection in breeding programs, accelerating the incorporation of improved drought tolerance into elite crop varieties. This approach would leverage natural variation in FTSH3 genes rather than relying on transgenic approaches, potentially facilitating regulatory approval and public acceptance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.