Recombinant Arabidopsis thaliana ATP-dependent zinc metalloprotease FTSH 4, mitochondrial (FTSH4)

Shipped with Ice Packs
In Stock

Description

Roles in Plant Physiology and Stress Response

FTSH4 is critical for maintaining mitochondrial integrity under stress conditions. Key findings include:

Mitochondrial Protein Quality Control

  • Degradation of oxidized proteins: FTSH4 targets carbonylated proteins, preventing aggregation and mitochondrial dysfunction .

  • Regulation of OXPHOS complexes: Ablation of FTSH4 reduces OXPHOS complex I and V activity, increases alternative oxidase (AOX) levels, and delays seed germination .

  • Protein import regulation: Controls turnover of TIM17-2, a subunit of the pre-sequence translocase-associated motor (PAM), ensuring proper mitochondrial protein biogenesis .

Phytohormone Signaling and Senescence

  • Salicylic acid (SA) regulation: ftsh4 mutants exhibit elevated SA levels, premature leaf senescence, and cell death. This is mediated via WRKY transcription factors (e.g., WRKY75) that upregulate SA biosynthesis genes (SID2, NPR1) .

  • Autophagy modulation: ftsh4 mutants show increased autophagic activity, as evidenced by elevated GFP-ATG8a fluorescence and LTG staining .

Table 2: Key Phenotypes in ftsh4 Mutants

PhenotypeObservationSource
SA Accumulation3.5–4.3× increase in PR1, SID2 mRNA
Autophagy70% autophagic cells vs. 0.47% in WT
ROS LevelsElevated, linked to perturbed OXPHOS
Germination DelayReduced OXPHOS subunits in late stages

Biochemical Interactions and Substrates

FTSH4 interacts with mitochondrial machinery and degrades specific substrates:

Identified Substrates

  • Pam18-2: A component of the PAM motor; degradation prevents protein import defects .

  • MPC4: Mitochondrial pyruvate carrier; FTSH4 regulates its stability .

  • Tim17-2: Subunit of TIM23 translocase; turnover ensures proper protein import .

Substrate Trapping Assays

Using a catalytically inactive FTSH4 variant (TRAP.FLAG), researchers identified substrates trapped in the proteolytic chamber. These include:

  • Oxidatively damaged proteins: Carbonylated proteins accumulate in ftsh4 mutants, indicating FTSH4’s role in clearing ROS-damaged substrates .

  • Mitochondrial dynamics proteins: Interactions with proteins involved in membrane remodeling and cristae formation .

Cross-Species Functional Conservation

FTSH4 orthologs in legumes (e.g., Lotus japonicus) share conserved functions. For example, LjFtsH4 is essential for symbiotic nitrogen fixation in nodules, highlighting its role in maintaining mitochondrial function during energy-intensive processes .

Research Challenges and Future Directions

  • Mechanistic insights: Elucidating how FTSH4 balances proteolytic and chaperone activities.

  • Therapeutic potential: Exploring FTSH4’s role in age-related mitochondrial dysfunction or stress tolerance in crops.

  • Structural biology: Solving the crystal structure of FTSH4 to guide inhibitor/activator design.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your requirements for preferential development of a specific tag.
Synonyms
FTSH4; At2g26140; T19L18.5; ATP-dependent zinc metalloprotease FTSH 4, mitochondrial; AtFTSH4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-717
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FTSH4
Target Protein Sequence
SSFPRVGVTGAVGGGGASLPRTRFQSSYVGSFARRVRDREEVNEVAHLRELIRRNDPEAV IRMFESQPSLHANASALSEYIKALVKVDRLDQSELVRTLQRGIAGVAREEETFGGLGAFR NVGKPTKDGVLGTASAPIHTISTERTHFKEQLWSTIRTIGVGFLLISGIGALIEDRGIGK GLGLHEEVQPSMDSSTKFSDVKGVDEAKAELEEIVHYLRDPKRFTRLGGKLPKGVLLVGP PGTGKTMLARAIAGEAGVPFFSCSGSEFEEMFVGVGARRVRDLFSAAKKCSPCIIFIDEI DAIGGSRNPKDQQYMKMTLNQMLVELDGFKQNEGIIVVAATNFPESLDKALVRPGRFDRH IVVPNPDVEGRRQILESHMSKVLKAEDVDLMIIARGTPGFSGADLANLVNVAALKAAMDG SKDVTMSDLEFAKDRIMMGSERKSAVISDESRKLTAFHEGGHALVAIHTEGALPVHKATI VPRGMALGMVSQLPDKDETSISRKQMLARLDVCMGGRVAEELIFGESEVTSGASSDLEQA TKLARAMVTKFGMSKEVGLVAHNYDDNGKSMSTETRLLIESEVKQLLEKAYNNAKTILTV YNKELHALANALLQHETLSGKQIKELLTDLNSPLLQKRQEVVTKQSNPVPPSTPSSASSA AAAAAAAAAAAAAAAATAATKGKDMAPVS
Uniprot No.

Target Background

Function
This protein is a probable ATP-dependent zinc metallopeptidase involved in the assembly and/or stabilization of mitochondrial complex V within the oxidative phosphorylation system.
Gene References Into Functions
  1. Growth arrest in the ftsh4-1 mutant stems from cell cycle dysregulation and loss of stem cell identity. PMID: 29538317
  2. Research identified novel (mitochondrial pyruvate carrier 4 (MPC4) and Pam18-2) and known (Tim17-2) substrates of FTSH4, demonstrating its role in degrading damaged proteins caused by oxidative stress in mitochondria. PMID: 29156584
  3. Maintaining mitochondrial function within the shoot apical meristem, dependent on AtFTSH4, is crucial for preserving stem cell activity throughout development. PMID: 27321362
  4. Loss of function of the transcription factor WRKY75 in ftsh4-4 mutants decreased salicylic acid (SA) levels and reversed the senescence phenotype. PMID: 28250067
  5. FTSH4 loss regulates development and architecture through peroxidase-dependent interactions between hydrogen peroxide and auxin homeostasis. PMID: 25763704
  6. Mitochondrial FtSH4 gene-mediated peroxidase accumulation regulates Arabidopsis architecture. PMID: 24482432
  7. Processing of the AtFtsH4 precursor by mitochondrial processing peptidase. PMID: 22986791
  8. AtFtsH4 is exclusively mitochondrial, whereas AtFtsH11 is found in both chloroplasts and mitochondria. PMID: 16247555
  9. AtFtsH4 deficiency impairs organelle development and Arabidopsis leaf morphology under short-day conditions. PMID: 19453455
Database Links

KEGG: ath:AT2G26140

STRING: 3702.AT2G26140.1

UniGene: At.23415

Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Intermembrane side.

Q&A

What is FTSH4 and where is it localized in plant cells?

FTSH4 is an ATP-dependent zinc metalloprotease that belongs to the family of FtsH proteases. In Arabidopsis thaliana, FTSH4 is specifically localized to the inner mitochondrial membrane with its catalytic domain facing the intermembrane space . This protease combines both proteolytic and chaperone-like activities, making it unique among mitochondrial proteins . FTSH4 shares homology with similar proteases in yeast (Yme1) and mammals, suggesting evolutionary conservation of its function across different organisms.

The protein is expressed throughout plant development but shows particularly high abundance during seed germination, where its expression pattern is dynamic. Both transcript and protein levels of FTSH4 are present in dry seeds, increase after stratification, peak at approximately 24 hours (when germination sensu stricto ends), and subsequently decrease . This expression pattern strongly indicates FTSH4's critical role during the germination process.

The specific localization of FTSH4 to the inner mitochondrial membrane is crucial for its function in regulating mitochondrial protein quality and phospholipid homeostasis, particularly cardiolipin content, which affects multiple mitochondrial processes, including the assembly and stability of respiratory complexes.

What phenotypes are observed in FTSH4-deficient plants?

Plants lacking functional FTSH4 display several distinct phenotypes:

  • Altered leaf morphology: When grown under short-day photoperiod at 22°C or long-day photoperiod at 30°C, ftsh4 mutants show visible changes in leaf development .

  • Delayed seed germination: One of the most notable phenotypes is a significant delay in seed germination, indicating FTSH4's importance during this critical developmental stage .

  • Mitochondrial abnormalities: ftsh4 mutants exhibit giant, spherical mitochondria coexisting with normal mitochondria, suggesting defects in mitochondrial dynamics, particularly in the fission process .

  • Oxidative stress: Widespread oxidative damage is observed in ftsh4 mitochondria, with numerous proteins from various submitochondrial compartments showing carbonylation .

  • Decreased OXPHOS activity: ftsh4 mutants display reduced activity of respiratory complexes, particularly complex V (ATP synthase), resulting in lower ATP production .

  • Reduced cardiolipin content: The mitochondrial membrane phospholipid cardiolipin is present at lower levels in ftsh4 mitochondria, which likely contributes to OXPHOS dysfunction and altered mitochondrial morphology .

These phenotypes collectively suggest that FTSH4 plays essential roles in maintaining mitochondrial function, particularly under conditions that impose additional stress on the organelle.

How does FTSH4 contribute to mitochondrial quality control?

FTSH4 contributes to mitochondrial quality control at multiple levels:

Protein quality control: As an ATP-dependent protease, FTSH4 likely participates in the degradation of damaged or misfolded proteins in the mitochondria, particularly those that have undergone oxidative modification . This proteolytic function prevents the accumulation of dysfunctional proteins that could impair mitochondrial function.

Regulation of phospholipid homeostasis: Evidence suggests that FTSH4 regulates the abundance of cardiolipin in the mitochondrial membrane, potentially through the proteolytic control of phospholipid regulators. This function appears similar to the role of FTSH4 homologs in yeast, where the i-AAA protease Yme1 mediates the turnover of proteins like Ups1 and Ups2 that regulate mitochondrial phospholipid content .

Indirect influence on mitochondrial dynamics: The reduced cardiolipin content in ftsh4 mitochondria is linked to restricted fission, which causes the appearance of giant mitochondria. This affects the cycles of fusion and fission that are essential for defense against mitochondrial damage and removal of damaged mitochondria through mitophagy .

Through these mechanisms, FTSH4 maintains mitochondrial integrity at both molecular and organellar levels, ensuring proper function of this essential organelle.

What is the relationship between FTSH4 and oxidative stress in plant mitochondria?

The relationship between FTSH4 and oxidative stress is complex and bidirectional. Research indicates that loss of FTSH4 leads to widespread oxidative damage in mitochondria, with proteins from various submitochondrial compartments showing carbonylation . This relationship can be examined through several interconnected mechanisms:

OXPHOS dysfunction and ROS production: In ftsh4 mutants, the reduced stability and activity of OXPHOS complexes, particularly complex V, lead to increased production of reactive oxygen species (ROS). The impaired electron transport chain becomes more prone to electron leakage, generating superoxide radicals that damage mitochondrial proteins, lipids, and DNA .

Cardiolipin deficiency and OXPHOS instability: FTSH4 maintains proper cardiolipin levels in mitochondrial membranes. When cardiolipin is reduced, as in ftsh4 mutants, OXPHOS complexes become destabilized, increasing ROS production. This creates a vicious cycle where ROS further damage the respiratory complexes, generating more ROS .

Impaired antioxidant defenses: Manganese superoxide dismutase, a key enzyme for eliminating mitochondrial superoxide radicals, is highly carbonylated and likely inactive in ftsh4 mutants, further exacerbating oxidative stress .

Secondary ROS sources: The oxidative damage of iron-sulfur proteins like aconitase or the 75-kD subunit of complex I can accelerate oxidative stress through the Fenton reaction, creating additional sources of ROS in ftsh4 mitochondria .

Reduced photorespiration: Several mitochondrial enzymes involved in photorespiration are highly carbonylated (GDC-T, SHM1, MTLPD1) or decreased in abundance (GLDP1, GLDP2) in ftsh4 mutants. Since photorespiration helps prevent ROS accumulation, its impairment likely contributes to oxidative stress .

Compensatory mechanisms: The ftsh4 mutant activates several protective mechanisms against oxidative stress, including increased expression of alternative oxidase (AOX1A) and alternative NADH dehydrogenases (NDB2, NDB4), which prevent overreduction of the electron transport chain and subsequent ROS production .

This complex interplay between FTSH4, mitochondrial function, and oxidative stress represents a key area for further investigation, with implications for understanding mitochondrial quality control in plants.

How does FTSH4 regulate cardiolipin content in mitochondrial membranes?

FTSH4 appears to regulate cardiolipin (CL) content in the mitochondrial membrane through a proteolytic pathway that resembles mechanisms described in yeast. While the exact molecular details in plants are still being elucidated, the following model can be proposed based on current evidence:

Proteolytic regulation of phospholipid regulators: FTSH4 likely controls the turnover of key regulatory proteins involved in cardiolipin biosynthesis or remodeling. In yeast, the FTSH4 homolog Yme1 (i-AAA protease) mediates the degradation of proteins like Ups1 and Ups2, which act as central regulators of mitochondrial phospholipid homeostasis .

Topological considerations: FTSH4's catalytic domain faces the intermembrane space, positioning it ideally to interact with and regulate proteins in this compartment that control phospholipid metabolism .

Consequences of CL deficiency: In ftsh4 mutants, reduced CL content leads to:

  • Destabilization of OXPHOS complexes

  • Altered mitochondrial dynamics, particularly restricted fission

  • Formation of giant, spherical mitochondria

  • Increased ROS production

  • Impaired mitophagy

The link between FTSH4 and cardiolipin represents a critical aspect of mitochondrial quality control, connecting protein degradation with phospholipid homeostasis and ultimately influencing mitochondrial structure and function.

What molecular mechanisms explain the defective seed germination in ftsh4 mutants?

The defective seed germination in ftsh4 mutants appears to be primarily linked to impaired biogenesis of the oxidative phosphorylation (OXPHOS) system. Multiple molecular mechanisms contribute to this phenotype:

Reduced OXPHOS protein abundance: Targeted proteomics using Multiple Reaction Monitoring (MRM) revealed that ftsh4 mutants have lower abundance of OXPHOS subunits during later stages of germination, while dry seeds and stratified seeds show comparable protein levels to wild-type .

Post-transcriptional regulation: Interestingly, transcript levels of mitochondrial and nuclear genes encoding OXPHOS subunits remain unchanged in ftsh4 mutants, indicating that the decreased protein abundance occurs at the post-transcriptional level .

Decreased cytochrome pathway activity: Functional analysis shows reduced activity of the cytochrome pathway in ftsh4 mutants during germination .

Compensatory increase in alternative respiration: ftsh4 mutants exhibit increased alternative oxidase (AOX1A) at both transcript and protein levels, accompanied by enhanced alternative pathway activity. This likely represents a compensatory response to defects in the main respiratory chain .

Temporal dynamics: The defect in OXPHOS biogenesis is most pronounced during the active phase of germination. By the time ftsh4 seeds eventually complete germination, OXPHOS protein levels become either slightly lower or comparable to wild-type seeds at a similar developmental stage .

Mitochondrial biogenesis coordination: FTSH4 appears to play a crucial role in coordinating the expression of both nuclear and mitochondrial genomes during seed germination, a process that requires strict regulation by molecular chaperones and proteases .

This integrated view explains how the absence of FTSH4 leads to delayed seed germination through impaired energy production and disrupted mitochondrial biogenesis during this energy-demanding developmental transition.

What strategies should be employed to study FTSH4 function in mitochondrial quality control?

To comprehensively investigate FTSH4's role in mitochondrial quality control, researchers should employ multi-faceted experimental approaches:

Genetic approaches:

  • Generate and characterize multiple ftsh4 alleles with varying levels of impairment

  • Create double mutants with other quality control components (e.g., LON proteases, mitochondrial chaperones)

  • Develop inducible knockdown/knockout systems to study acute loss of FTSH4

  • Implement complementation studies with FTSH4 variants harboring specific mutations in catalytic domains

Biochemical characterization:

  • Purify recombinant FTSH4 to assess its proteolytic activity in vitro

  • Identify direct substrates through co-immunoprecipitation and mass spectrometry

  • Analyze the degradation kinetics of carbonylated proteins in isolated mitochondria with and without ATP supplementation

  • Employ protease inhibitors to distinguish FTSH4-specific proteolytic activities from other mitochondrial proteases

Mitochondrial function assessment:

  • Measure respiratory complex activities and assembly using Blue Native PAGE

  • Quantify ATP production in isolated mitochondria under various conditions

  • Analyze ROS production using fluorescent probes

  • Assess mitochondrial membrane potential in wild-type and ftsh4 plants

Lipidomic analysis:

  • Perform comprehensive phospholipid profiling of mitochondrial membranes

  • Quantify cardiolipin content and species composition

  • Study the effect of altered phospholipid composition on OXPHOS stability

  • Analyze the interaction between phospholipids and specific proteins

Advanced microscopy:

  • Implement live-cell imaging to visualize mitochondrial dynamics

  • Use super-resolution microscopy to characterize abnormal mitochondrial morphology

  • Perform electron microscopy to examine ultrastructural changes

  • Employ fluorescence recovery after photobleaching (FRAP) to study membrane fluidity

Omics integration:

  • Combine targeted proteomics (MRM) with transcriptomics to identify post-transcriptional regulation

  • Utilize metabolomics to characterize changes in mitochondrial metabolism

  • Implement systems biology approaches to integrate multiple data types

These comprehensive strategies will provide mechanistic insights into FTSH4's role in mitochondrial quality control and its importance for plant development and stress responses.

How can researchers effectively analyze OXPHOS defects in ftsh4 mutants?

Effective analysis of OXPHOS defects in ftsh4 mutants requires a comprehensive toolbox of complementary techniques:

Targeted proteomics using Multiple Reaction Monitoring (MRM):

  • This highly sensitive and precise method allows quantification of specific OXPHOS subunits

  • MRM can detect subtle changes in protein abundance not detectable by traditional methods

  • Researchers should design peptide targets specific to subunits of each OXPHOS complex

  • Include proteins from various submitochondrial compartments as controls

Respiratory measurements:

  • Oxygen consumption rates in isolated mitochondria using a Clark-type electrode

  • Substrate-specific respiratory activities to assess individual complex functions

  • Inhibitor titrations to distinguish between cytochrome and alternative pathways

  • In vivo respiratory measurements using specialized equipment for intact tissues

Biochemical analysis of OXPHOS complexes:

  • Blue Native PAGE to assess complex assembly and stability

  • In-gel activity assays for individual complexes

  • Complex purification and proteomic analysis to identify subunit composition changes

  • Crosslinking studies to analyze supercomplex formation

Functional assays:

  • ATP synthesis rates in isolated mitochondria

  • Membrane potential measurements using fluorescent dyes

  • ROS production assessment using specific probes

  • Analysis of proton pumping efficiency

Structural studies:

  • Electron microscopy to visualize cristae morphology, which reflects OXPHOS organization

  • Super-resolution microscopy to examine OXPHOS complex distribution

  • Atomic force microscopy for nanoscale topography of inner membrane complexes

Genetic complementation:

  • Expression of individual OXPHOS subunits in ftsh4 background

  • Introduction of alternative energy-generating systems

  • Suppressor screens to identify compensatory mutations

Developmental stage-specific analysis:

  • Time-course studies during seed germination to capture dynamic changes

  • Comparison of multiple tissues and developmental stages

  • Stress conditions that exacerbate OXPHOS defects

The integration of these approaches will provide a comprehensive understanding of how FTSH4 deficiency impacts OXPHOS function, assembly, and regulation throughout development.

What experimental approaches can reveal FTSH4 substrates and interacting partners?

Identifying FTSH4 substrates and interacting partners is crucial for understanding its function. Multiple complementary approaches should be employed:

Substrate trap approaches:

  • Generate catalytically inactive FTSH4 variants (e.g., mutations in the ATPase or zinc-binding domains)

  • Express these "substrate traps" in ftsh4 mutant background

  • Purify the protease complex and identify trapped substrates by mass spectrometry

  • This approach prevents substrate degradation while maintaining binding

Comparative proteomics:

  • Compare mitochondrial proteomes of wild-type and ftsh4 mutants

  • Focus on proteins with increased abundance in mutants, which may represent substrates

  • Analyze post-translational modifications, particularly oxidative modifications

  • Use stable isotope labeling (SILAC) or isobaric tags for accurate quantification

Immunoprecipitation-based approaches:

  • Co-immunoprecipitation using tagged FTSH4 followed by mass spectrometry

  • Proximity-dependent biotin identification (BioID) with FTSH4 as the bait

  • Cross-linking immunoprecipitation to capture transient interactions

  • Two-hybrid screens adapted for membrane proteins

In vitro degradation assays:

  • Purify recombinant FTSH4 and candidate substrates

  • Assess degradation kinetics under various conditions

  • Test competition between substrates

  • Analyze the effect of ATP, zinc, and pH on substrate specificity

Genetic interaction studies:

  • Epistasis analysis with mutants of potential substrates

  • Synthetic lethality screens to identify functional relationships

  • Suppressor screens to find genes that can compensate for FTSH4 loss

  • CRISPR-based screens for genes showing genetic interactions with FTSH4

Structural biology approaches:

  • Cryo-electron microscopy of FTSH4 complexes with substrates

  • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

  • Computational docking to predict substrate binding sites

Transcriptional profiling:

  • RNA-seq analysis comparing wild-type and ftsh4 mutants

  • Identification of transcriptionally upregulated genes that may encode substrates

  • Analysis of genes co-expressed with FTSH4 across conditions

These approaches will help build a comprehensive substrate and interactome map for FTSH4, providing insights into its multifaceted roles in mitochondrial quality control.

How should researchers analyze the seemingly contradictory functions of FTSH4 in different submitochondrial compartments?

Researchers face an intriguing paradox when studying FTSH4: while its catalytic domain faces the intermembrane space, several of its apparent substrates and affected processes are located in the matrix . This topological incompatibility requires careful analysis:

Mechanistic hypotheses to resolve topological contradictions:

  • Indirect regulation model: FTSH4 may directly process regulators in the intermembrane space that subsequently influence matrix processes. For example, FTSH4 could degrade signaling molecules that control matrix proteases or chaperones .

  • Membrane protein intermediaries: FTSH4 might target membrane proteins with domains extending into both compartments, thus indirectly affecting matrix processes.

  • Small molecule mediators: The protease activity of FTSH4 could release peptides or alter lipid composition, which subsequently affects matrix functions.

  • Unidentified topology: Some FTSH4 molecules might have different membrane orientation or localization under specific conditions.

Experimental approaches to address the contradiction:

  • Submitochondrial fractionation: Carefully isolate intermembrane space, inner membrane, and matrix fractions to track proteins and activities affected by FTSH4 loss.

  • Proximity labeling: Use spatially restricted labeling technologies (BioID, APEX) fused to FTSH4 to identify proteins in its vicinity.

  • Topology mapping: Employ protease protection assays and site-specific labeling to confirm FTSH4's topology under various conditions.

  • Domain-specific mutations: Create FTSH4 variants with mutations in specific domains to determine which are essential for different functions.

  • Time-course studies: Analyze the temporal sequence of events following FTSH4 inactivation to distinguish primary from secondary effects.

Analytical framework for interpretation:

CompartmentObserved Effect in ftsh4Potential MechanismRequired Evidence
Intermembrane SpaceDirect substrate accumulationDirect proteolysisSubstrate-FTSH4 interaction, in vitro degradation
Inner MembraneAltered phospholipid compositionProteolysis of lipid regulatorsIdentification of lipid regulator substrates
MatrixCarbonylated protein accumulationIndirect effect via membrane alterationsTemporal sequence showing membrane effects precede matrix effects
MatrixAltered OXPHOS complexesImpact on protein import or assemblyImport assays, assembly intermediate analysis

By systematically testing these possibilities and integrating data across multiple approaches, researchers can resolve the apparent contradictions in FTSH4 function and develop a unified model of its role in mitochondrial homeostasis.

What can we learn from comparing ftsh4 phenotypes across different developmental stages and stress conditions?

Comparative analysis of ftsh4 phenotypes across developmental stages and stress conditions provides valuable insights into FTSH4's context-dependent functions:

Developmental stage comparisons:

  • Seed germination: ftsh4 mutants show delayed germination associated with reduced OXPHOS protein abundance and impaired respiratory chain activity, suggesting a crucial role for FTSH4 in mitochondrial biogenesis during this energy-demanding transition .

  • Post-germination growth: Phenotypic alterations in leaf morphology become apparent under specific conditions (short-day photoperiod at 22°C or long-day photoperiod at 30°C), indicating environment-dependent requirements for FTSH4 .

  • Expression pattern correlation: FTSH4 protein and transcript levels peak after 24 hours of germination and subsequently decrease, aligning with the timing of germination completion and suggesting stage-specific regulation .

Stress condition analysis:

  • Temperature sensitivity: ftsh4 phenotypes are more pronounced at elevated temperatures (30°C), suggesting increased demand for mitochondrial quality control under thermal stress .

  • Photoperiod interaction: The combination of long-day photoperiod and elevated temperature exacerbates ftsh4 phenotypes, indicating interactions between light signaling and mitochondrial function .

  • Oxidative stress responses: ftsh4 mutants show upregulation of alternative respiratory pathways and stress-responsive chaperones, representing compensatory mechanisms activated under mitochondrial dysfunction .

Analytical framework for cross-condition comparison:

ConditionPrimary PhenotypeSecondary EffectsImplied FTSH4 Function
Seed germinationDelayed germinationReduced OXPHOS proteinsOXPHOS biogenesis support
Elevated temperatureAltered leaf morphologyIncreased protein carbonylationProtein quality control
Short-day/22°CMild growth defectsMitochondrial morphology changesMembrane lipid homeostasis
Long-day/30°CSevere growth defectsWidespread oxidative damageIntegrated stress response

Methodological approaches for comparative analysis:

  • Controlled environment studies: Systematically vary temperature, light, and other parameters to identify condition-specific requirements for FTSH4.

  • Time-course experiments: Track the progression of molecular and physiological changes across development.

  • Multi-omics integration: Compare transcriptomes, proteomes, and metabolomes across conditions to identify convergent and divergent responses.

  • Genetic interaction mapping: Test if ftsh4 phenotypes are suppressed or enhanced by mutations in stress response pathways under different conditions.

This comparative approach reveals FTSH4's multifaceted roles and helps distinguish its primary functions from secondary consequences of its absence.

How can researchers distinguish between direct and indirect effects of FTSH4 deficiency?

Distinguishing direct from indirect effects of FTSH4 deficiency is crucial for understanding its primary functions. Researchers should employ multiple strategies:

Temporal sequence analysis:

  • Time-course studies: Implement high-resolution time-course experiments following inactivation of FTSH4 (using inducible systems) to establish the sequence of events .

  • Primary effect criteria: Effects occurring earliest after FTSH4 loss are more likely to be direct consequences.

  • Causal chain mapping: Construct potential causal relationships between observed phenomena and test these models with targeted interventions.

Biochemical validation:

  • In vitro reconstitution: Test whether purified FTSH4 can directly act on suspected substrates or processes in reconstituted systems.

  • Substrate affinity measurements: Quantify binding affinity and degradation kinetics of putative direct substrates.

  • Competition assays: Determine if suspected direct substrates compete for FTSH4 activity, suggesting shared interaction mechanisms .

Genetic suppression analysis:

  • Targeted suppression: Test whether manipulating suspected downstream pathways can rescue specific ftsh4 phenotypes.

  • Mechanistic suppression: Distinguish between bypass suppression (alternative pathway activation) and direct suppression (restoring the primary function).

  • Hierarchical relationship: Establish genetic hierarchies through epistasis analysis with genes in related pathways.

Correlation versus causation framework:

Observation in ftsh4Evidence for Direct EffectEvidence for Indirect EffectDistinguishing Experiment
Carbonylated protein accumulationDegradation by purified FTSH4Occurs after lipid changesTime-course with lipid supplementation
Reduced cardiolipinFTSH4 degrades lipid regulatorsSecondary to OXPHOS dysfunctionPurify and test lipid regulator degradation
Giant mitochondriaDirect impact on fission machinerySecondary to cardiolipin depletionCardiolipin supplementation experiment
Delayed germinationFTSH4 processes germination regulatorsConsequence of energy deficiencyATP supplementation studies

Multi-level rescue experiments:

  • Compartment-specific complementation: Express FTSH4 targeted to specific submitochondrial compartments to rescue distinct phenotypes.

  • Domain-specific mutations: Test which functional domains of FTSH4 are required for different phenotypes.

  • Substrate-specific interventions: Modify expression of suspected direct substrates to mimic their FTSH4-regulated states.

  • Lipid supplementation: Test whether providing cardiolipin or its precursors can rescue specific phenotypes .

By integrating these approaches, researchers can build a hierarchical model of FTSH4 functions, distinguishing its direct biochemical roles from the cascade of secondary effects that follow from its absence.

What are promising approaches to identify the complete set of FTSH4 substrates in plants?

Identifying the complete set of FTSH4 substrates requires innovative approaches that overcome challenges specific to membrane-bound proteases:

Advanced proteomics strategies:

  • Substrate trapping proteomics: Express catalytically inactive FTSH4 variants with preserved substrate binding to capture transient interactions, followed by crosslinking and mass spectrometry.

  • Degradomics approaches: Use N-terminomics to identify protein fragments generated by FTSH4-mediated proteolysis, comparing wild-type and ftsh4 mutants.

  • Quantitative spatial proteomics: Compare protein abundance changes in specific submitochondrial compartments between wild-type and ftsh4 mutants.

  • Turnover rate analysis: Use stable isotope labeling to measure protein half-lives in wild-type and ftsh4 plants, focusing on proteins with extended half-lives in the mutant.

Biochemical validation pipeline:

  • Recombinant substrate library: Create a library of potential substrates for high-throughput in vitro degradation assays.

  • Structural determinants: Identify sequence or structural motifs that determine FTSH4 substrate recognition.

  • Post-translational modification impact: Test how oxidative modifications affect substrate recognition and processing by FTSH4.

  • Reconstituted membrane systems: Study FTSH4 activity in liposomes with defined lipid composition to understand membrane context effects .

Computational approaches:

  • Machine learning predictions: Train algorithms on known substrates to predict additional candidates based on sequence, structure, and localization.

  • Evolutionary conservation analysis: Identify conserved FTSH4 substrates across species by comparative genomics.

  • Protein interaction networks: Map FTSH4 in the context of mitochondrial protein-protein interaction networks to identify functional clusters.

  • Integrative multi-omics modeling: Combine proteomics, transcriptomics, and metabolomics data to infer regulatory relationships centered on FTSH4.

Specialized in vivo approaches:

  • Proximity labeling in specific conditions: Apply techniques like BioID or APEX2 fused to FTSH4 under various stress conditions to capture condition-specific interactions.

  • Single-cell proteomics: Analyze FTSH4 substrates at the single-cell level to capture cell-type specific functions.

  • Tissue-specific FTSH4 complementation: Express FTSH4 in specific tissues of ftsh4 mutants to identify tissue-dependent substrates.

  • Interspecies complementation: Express FTSH4 homologs from diverse species to identify evolutionarily conserved versus species-specific functions.

These comprehensive approaches will help construct a complete substrate map for FTSH4, illuminating its diverse roles in mitochondrial quality control and plant physiology.

How might FTSH4 function interact with other mitochondrial quality control mechanisms?

FTSH4 likely functions within an integrated network of mitochondrial quality control mechanisms. Understanding these interactions requires investigation at multiple levels:

Interactions with other proteases:

  • Cooperative substrate processing: FTSH4 might participate in sequential processing of substrates with other proteases like LON1 or FTSH3/10. In ftsh4 mutants, upregulation of LON1 and FTSH10 at the transcriptional level and FTSH3 at the protein level suggests compensatory relationships .

  • Compartment-specific coordination: While FTSH4's catalytic domain faces the intermembrane space, matrix proteases like LON1 handle quality control in that compartment. The communication between these compartmentalized systems requires investigation.

  • Substrate specificity overlap: Determine whether FTSH4 shares substrates with other proteases or processes unique targets. This can be addressed through comparative degradomics in different protease mutants.

Integration with chaperone systems:

  • Chaperone-protease handoff: FTSH4 may receive substrates from mitochondrial chaperones like HSP60 and HSP70, which are upregulated in ftsh4 mutants .

  • Co-chaperone function: FTSH4 itself possesses chaperone-like activity that might contribute to protein folding and assembly independently of its proteolytic function.

  • Stress-induced cooperation: Under stress conditions, the coordination between FTSH4 and chaperone systems might be enhanced to cope with increased protein damage.

Relationship with mitochondrial dynamics:

  • Fission/fusion balance: FTSH4 influences cardiolipin content, which affects mitochondrial fission. The appearance of giant mitochondria in ftsh4 suggests impaired fission machinery .

  • Mitophagy regulation: Defective fission in ftsh4 may block mitophagy, preventing the elimination of damaged mitochondria and creating a vicious cycle of damage accumulation .

  • Integration with retrograde signaling: Determine whether FTSH4 processes signaling molecules that communicate mitochondrial status to the nucleus.

Cooperative quality control model:

Quality Control LevelFTSH4 RoleInteracting MechanismsPhenotype in ftsh4
Protein levelDegradation of damaged proteinsCoordination with other proteases and chaperonesCarbonylated protein accumulation
Membrane levelRegulation of phospholipid compositionInteraction with lipid biosynthesis/remodeling enzymesReduced cardiolipin, destabilized OXPHOS
Organelle levelInfluence on mitochondrial dynamicsCrossover with fission/fusion machineryGiant mitochondria, impaired mitophagy
Cellular levelContribution to retrograde signalingIntegration with cellular stress responsesCompensatory upregulation of stress genes

This integrative approach will illuminate how FTSH4 functions within the broader context of mitochondrial quality control and reveal potential compensatory mechanisms that could be therapeutically targeted.

What technologies could advance our understanding of FTSH4 in real-time and in vivo?

Cutting-edge technologies offer promising avenues to study FTSH4 dynamics and function in unprecedented detail:

Advanced imaging technologies:

  • Super-resolution microscopy: Techniques such as PALM, STORM, or STED microscopy can visualize FTSH4 distribution and dynamics with nanometer precision, resolving its organization within mitochondrial membranes.

  • Live-cell proteolysis sensors: Develop FRET-based reporters that change fluorescence upon cleavage by FTSH4, allowing real-time monitoring of its activity in living cells.

  • Correlative light and electron microscopy (CLEM): Combine fluorescence imaging of FTSH4 with ultrastructural analysis of mitochondrial morphology.

  • Lattice light-sheet microscopy: Capture rapid FTSH4 dynamics with minimal phototoxicity over extended periods.

Molecular sensors and reporters:

  • Activity-based protein profiling: Develop specific probes that bind active FTSH4, allowing visualization and quantification of its proteolytic activity in vivo.

  • Split fluorescent protein complementation: Monitor FTSH4 interactions with substrates or regulatory partners in real-time using bimolecular fluorescence complementation.

  • Targeted redox sensors: Place redox-sensitive fluorescent proteins near FTSH4 to monitor the local redox environment that influences its activity.

  • Single-molecule tracking: Follow individual FTSH4 molecules to understand their mobility, clustering, and interaction dynamics.

Genetic tools for spatiotemporal control:

  • Optogenetic regulation: Develop light-controlled FTSH4 variants that can be activated or inactivated with specific wavelengths of light.

  • Chemical genetics approaches: Engineer FTSH4 variants sensitive to small molecules for rapid, reversible control of activity.

  • Cell-type specific expression: Use tissue-specific promoters or single-cell techniques to study FTSH4 function in specific contexts.

  • Inducible degron systems: Create systems for rapid degradation of FTSH4 to distinguish acute from adaptive responses.

Integrative multi-scale approaches:

  • Spatial transcriptomics and proteomics: Map transcriptional and protein-level responses to FTSH4 activity with subcellular resolution.

  • Cryo-electron tomography: Visualize FTSH4 complexes in their native mitochondrial membrane environment at near-atomic resolution.

  • Microfluidics combined with live imaging: Track responses to controlled perturbations in real-time at the single-cell level.

  • In vivo stable isotope labeling: Monitor protein turnover and mitochondrial metabolic fluxes in intact plants.

These technologies will transform our understanding of FTSH4 from static snapshots to dynamic processes in living systems, revealing how this protease functions within the complex environment of plant mitochondria under physiological and stress conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.