Recombinant Arabidopsis thaliana ATP-dependent zinc metalloprotease FTSH 5, chloroplastic (FTSH5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FTSH5; FTSH2; VAR1; At5g42270; K5J14.7; ATP-dependent zinc metalloprotease FTSH 5, chloroplastic; AtFTSH5; Protein VARIEGATED 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
77-704
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FTSH5
Target Protein Sequence
VNEPVQPPAPTITAEAQSPNLSTFGQNVLMTAPNPQAQSSDLPDGTQWRYSEFLNAVKKG KVERVKFSKDGSVLQLTAVDNRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFDFI GNLLFPLLAFGGLFYLFRGGQGGAGGPGGLGGPMDFGRSKSKFQEVPETGVTFGDVAGAD QAKLELQEVVDFLKNPDKYTALGAKIPKGCLLVGPPGTGKTLLARAVAGEAGVPFFSCAA SEFVELFVGVGASRVRDLFEKAKSKAPCIVFIDEIDAVGRQRGAGMGGGNDEREQTINQL LTEMDGFSGNSGVIVLAATNRPDVLDSALLRPGRFDRQVTVDRPDVAGRVQILKVHSRGK AIGKDVDYEKVARRTPGFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEK KNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESG LYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGFSKKIGQ VAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYVRAKEIITTQIDILHKLA QLLIEKETVDGEEFMSLFIDGQAELYVS
Uniprot No.

Target Background

Function

This protein is a component of a complex functioning as an ATP-dependent zinc metallopeptidase. It plays a role in thylakoid formation and the removal of damaged D1 protein in photosystem II, thus preventing cell death under high-light conditions. It is not involved in the degradation of the light-harvesting complex of photosystem II (LHC II) or in thermotolerance.

Gene References Into Functions
  1. AtJ8 protein levels were significantly reduced in the var1 mutant, lacking the FTSH5 protease. AtJ8, predominantly expressed in darkness, exhibits rapid turnover but is partially stabilized by FTSH proteases. PMID: 21592617
  2. The Sec pathway facilitates FtsH5 integration into thylakoids. PMID: 21214651
Database Links

KEGG: ath:AT5G42270

STRING: 3702.AT5G42270.1

UniGene: At.21670

Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein; Stromal side.
Tissue Specificity
Ubiquitous.

Q&A

What is the basic structure and localization of FTSH5 in Arabidopsis thaliana?

FTSH5 is a transmembrane metalloprotease located in the thylakoid membrane of chloroplasts. It contains an ATP-binding domain and a zinc-binding catalytic site that is essential for its proteolytic activity. FTSH5 is classified as a type A FtsH protein and forms heterohexameric complexes with other FtsH family members in the thylakoid membrane . The protein is encoded by the gene At5g42270 in the Arabidopsis genome and has a molecular weight of approximately 67.1 kDa .

How does FTSH5 contribute to chloroplast development and function?

FTSH5 plays a crucial role in protein quality control within the thylakoid membrane, which is essential for proper chloroplast development. It is particularly important for the specific degradation of photo-damaged D1 protein in the photosystem II (PSII) complex, thereby maintaining photosynthetic activity . Mutants lacking FTSH5 often display impaired chloroplast biogenesis and reduced photosynthetic efficiency, highlighting its importance for chloroplast development during leaf growth .

What is the relationship between FTSH5 and other FtsH family proteins in thylakoid membranes?

FTSH5 is one of five FtsH homologues (FtsH1, 2, 5, 6, and 8) that function in the thylakoid membrane. Four of these proteins (FtsH1, 2, 5, and 8) form a heterohexameric complex and are divided into two types: type A (FtsH1/FtsH5) and type B (FtsH2/FtsH8) . This classification is based on sequence similarity and functional redundancy. The proper function of the FtsH complex requires the presence of both type A and type B subunits in appropriate stoichiometry, typically with a ratio of 2:4 (type A:type B) in the heterohexamer .

How is FTSH5 involved in plant stress response mechanisms?

FTSH5 expression is regulated in response to various environmental stresses, particularly light stress. Research indicates that FTSH5 interacts with FIP (FtsH5 Interacting Protein), which possesses a zinc-finger domain and is also involved in stress responses . Interestingly, while FTSH5 is essential for normal chloroplast function, the expression of FIP is down-regulated in plants exposed to high light intensity, oxidative, salt, and osmotic stresses . Plants with mutations affecting FTSH5 and its interacting partners show altered responses to abiotic stresses, suggesting a regulatory role for FTSH5 in stress adaptation pathways .

What is the significance of FTSH5 phosphorylation and how can it be studied?

FTSH5 undergoes phosphorylation, which may affect its stability in thylakoid membranes or its complex formation. Phosphate-affinity gel electrophoresis using Phos-Tag molecules has revealed that both type A (including FTSH5) and type B FtsH subunits exist in phosphorylated and non-phosphorylated forms . Research indicates that Ser-212 may play a role in FTSH5 stability in the thylakoid membranes, as demonstrated through site-directed mutagenesis studies . Interestingly, FTSH5 phosphorylation appears to be independent of the light-dependent regulation typically observed for other photosynthesis-related proteins, as neither different light conditions nor the absence of major thylakoid kinases (STN7 and STN8) significantly affects FTSH5 phosphorylation status .

How does the thermo-sensitivity of FTSH5 and related proteins affect experimental design?

The function of FTSH5 and related proteins shows temperature dependency, as evidenced by the thermo-sensitive phenotype of the FtsHi5/TSL2 mutant. This mutant displays a weak yellowish phenotype at normal growth temperature (22°C), which becomes more pronounced at lower temperatures (16°C) and is largely rescued at higher temperatures (29°C) . When designing experiments involving FTSH5, researchers should carefully control temperature conditions and potentially include multiple temperature regimes to fully characterize protein function. Temperature-shift experiments can be particularly valuable for studying the role of FTSH5 in chloroplast development under different environmental conditions .

What are the recommended methods for detecting and quantifying FTSH5 in plant tissues?

For detecting FTSH5 in plant tissues, western blot analysis using specific antibodies is the most common approach. Polyclonal antibodies against recombinant Arabidopsis thaliana FTSH5 (like the commercially available AS16 3930) can be used at a recommended dilution of 1:5000 for western blotting . For sample preparation, total proteins should be isolated from plant tissue, immediately frozen in liquid nitrogen, and pulverized. Proteins can then be extracted with an appropriate buffer, and after measuring chlorophyll concentration, samples should be loaded equally (based on chlorophyll content, typically 0.5 μg chlorophyll/lane) for SDS-PAGE analysis . For quantitative analysis, TMT (Tandem Mass Tag) isobaric labeling coupled with mass spectrometry provides comprehensive insights into changes in FTSH5 abundance relative to other chloroplast proteins .

How can researchers effectively study FTSH5 interactions with other proteins?

Multiple complementary approaches should be used to study FTSH5 interactions:

  • Yeast two-hybrid assays: This technique has successfully identified interactions between FTSH5 and other proteins, such as FIP .

  • Pull-down experiments: To confirm interactions identified by two-hybrid assays, in vitro pull-down experiments using recombinant proteins can be performed .

  • Co-immunoprecipitation: For in vivo confirmation of interactions, co-immunoprecipitation with antibodies against FTSH5 followed by mass spectrometry analysis of co-precipitated proteins.

  • Fluorescence microscopy: GFP fusion proteins can be used to visualize co-localization of FTSH5 with its interacting partners in vivo .

  • Two-dimensional clear-native/Phos-tag SDS-PAGE: This approach can be used to analyze different phosphorylation states of FTSH5 oligomers and how phosphorylation affects complex formation or stability .

What genetic approaches are most effective for studying FTSH5 function in vivo?

Genetic ApproachMethodologyAdvantagesLimitations
T-DNA insertion mutantsIsolation of homozygous mutants from Arabidopsis T-DNA librariesComplete knockout of gene functionMay be lethal if FTSH5 function is essential
RNAi knockdownGeneration of transgenic plants with reduced FTSH5 expressionAllows study of partial loss of functionVariable efficiency of gene silencing
CRISPR/Cas9 editingTargeted mutation of specific FTSH5 domainsPrecise modification of functional domainsRequires careful design to avoid off-target effects
Site-directed mutagenesisIntroduction of specific mutations (e.g., Ser-212 to Ala)Allows study of specific amino acid functionsRequires complementation in appropriate mutant background
Forward genetic screeningIdentification of mutants with altered phenotypes (e.g., thermo-sensitive)Can discover novel regulatory mechanismsLabor-intensive and may yield indirect effects

For effective genetic analysis, researchers should consider using the var2 mutant (lacking FtsH2) as a control or background for FTSH5 studies, as it has a well-characterized phenotype related to FtsH complex function .

How can researchers address the functional redundancy between FTSH5 and other FtsH proteins?

The functional redundancy between FTSH5 and other FtsH proteins, particularly FtsH1 (the other type A FtsH), presents a challenge for researchers studying specific functions of FTSH5. To address this, several approaches are recommended:

  • Double or triple mutant analysis: Generate and characterize plants lacking multiple FtsH proteins to overcome redundancy issues.

  • Conditional expression systems: Use inducible promoters to control the expression of specific FtsH proteins in different mutant backgrounds.

  • Domain-swapping experiments: Create chimeric proteins combining domains from different FtsH proteins to identify the regions responsible for specific functions.

  • Tissue-specific or developmental stage-specific analyses: Examine whether FTSH5 has unique roles in specific tissues or developmental contexts where redundancy may be limited .

What are the emerging research directions for understanding FTSH5's role in chloroplast proteostasis?

Recent studies suggest several promising research directions:

  • Stress-specific regulation: Investigating how FTSH5 activity is regulated under different stress conditions, particularly focusing on the relationship between phosphorylation status and stress response .

  • Integration with other proteolytic systems: Exploring how FTSH5 coordinates with other chloroplast proteases to maintain proteostasis under changing environmental conditions.

  • Substrate specificity: Identifying the complete range of FTSH5 substrates beyond the well-characterized D1 protein, potentially using proteomics approaches.

  • Cross-talk with signaling pathways: Examining how FTSH5 activity is integrated with chloroplast-to-nucleus signaling pathways that regulate gene expression in response to chloroplast status .

  • Evolutionary conservation: Comparative analysis of FTSH5 function across different plant species to understand conserved and divergent aspects of its role in chloroplast development and stress response.

How can advanced proteomics approaches enhance our understanding of FTSH5 function?

Quantitative proteomics using techniques such as TMT isobaric labeling has already provided insights into broad changes in the chloroplast proteome of plants with altered FTSH5 function . Future research could employ more sophisticated proteomics approaches including:

  • Proximity-dependent biotin identification (BioID): For identifying proteins that transiently interact with FTSH5 in vivo.

  • Stable isotope labeling by amino acids in cell culture (SILAC): For quantitative analysis of proteome changes in response to altered FTSH5 activity.

  • Degradomics: To identify specific protein substrates of FTSH5 by analyzing the accumulation of potential substrates in FTSH5-deficient plants.

  • Post-translational modification analysis: Comprehensive mapping of phosphorylation and other modifications of FTSH5 under different conditions to understand regulatory mechanisms .

What are the key considerations when designing experiments involving recombinant FTSH5?

When working with recombinant FTSH5, researchers should consider:

  • Expression system selection: Choosing an appropriate heterologous expression system that can produce properly folded, active FTSH5 with its transmembrane domain.

  • Purification strategy: Developing a purification protocol that maintains the native conformation and activity of FTSH5, likely requiring detergent solubilization.

  • Activity assays: Establishing reliable assays to measure the proteolytic activity of recombinant FTSH5 against known substrates.

  • Storage conditions: Determining optimal conditions for maintaining FTSH5 stability during storage, particularly considering its membrane protein nature.

  • Temperature sensitivity: Accounting for the temperature-dependent activity of FTSH5 when designing experiments, especially considering the thermosensitive phenotypes observed in related mutants .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.