Recombinant Arabidopsis thaliana ATP-dependent zinc metalloprotease FTSH 6, chloroplastic (FTSH6)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana ATP-dependent Zinc Metalloprotease FTSH 6, Chloroplastic (FTSH6)

Arabidopsis thaliana ATP-dependent zinc metalloprotease FTSH 6, chloroplastic (FTSH6), is a metalloprotease that belongs to the FtsH family and is found in the chloroplasts of Arabidopsis thaliana . FtsH proteases are ATP-dependent metalloproteases involved in various cellular processes, including protein quality control and degradation of damaged proteins . FtsH6 is involved in the degradation of the light-harvesting complex of Photosystem II (LHC II) .

Basic Information

CharacteristicDescription
Gene NameFTSH6
SynonymsFTSH6; At5g15250; F8M21.140; ATP-dependent zinc metalloprotease FTSH 6, chloroplastic; AtFTSH6
SpeciesArabidopsis thaliana
SourceE. coli
TagHis
Protein LengthFull Length of Mature Protein (84-688)
UniProt IDQ1PDW5
Molecular Weight74.36 kDa
AA SequenceEAPIEATSNRMSYSRFLQHLKENEVKKVDLIENGTVAIVEISNPVVGKIQRVRVNLPGLP VDLVREMKEKNVDFAAHPMNVNWGAFLLNFLGNLGFPLILLVSLLLTSSSRRNPAGPNLP FGLGRSKAKFQMEPNTGITFEDVAGVDEAKQDFEEIVEFLKTPEKFSALGAKIPKGVLLT GPPGTGKTLLAKAIAGEAGVPFFSLSGSEFIEMFVGVGASRARDLFNKAKANSPCIVFID EIDAVGRMRGTGIGGGNDEREQTLNQILTEMDGFAGNTGVIVIAATNRPEILDSALLRPG RFDRQVSVGLPDIRGREEILKVHSRSKKLDKDVSLSVIAMRTPGFSGADLANLMNEAAIL AGRRGKDKITLTEIDDSIDRIVAGMEGTKMIDGKSKAIVAYHEVGHAICATLTEGHDPVQ KVTLVPRGQARGLTWFLPGEDPTLVSKQQLFARIVGGLGGRAAEDVIFGEPEITTGAAGD LQQVTEIARQMVTMFGMSEIGPWALTDPAVKQNDVVLRMLARNSMSEKLAEDIDSCVKKI IGDAYEVAKKHVRNNREAIDKLVDVLLEKETLTGDEFRAILSEYTDQPLNTDGDVRIRIN DLISV

Function and Role of FTSH6

  1. Degradation of LHC II: FTSH6 functions as a protease responsible for the degradation of the light-harvesting complex II (LHC II) apoproteins . This degradation is crucial under various environmental conditions, such as light stress or dark-induced senescence, to prevent photochemical damage to the reaction center .

  2. Thermomemory Regulation: FtsH6, along with small heat shock protein HSP21, regulates thermomemory in Arabidopsis . During thermorecovery, heat shock factor HSFA2 activates FtsH6 expression, which degrades HSP21 to reset memory to its pre-stress abundance .

  3. Protein Quality Control: FtsH is an essential ATP-dependent metalloprotease for protein quality control in the thylakoid membrane of Arabidopsis thaliana chloroplasts . It is required for chloroplast development during leaf growth and the degradation of photo-damaged D1 protein in the photosystem II (PSII) complex to maintain photosynthesis activity .

Phosphorylation of FTSH

  • FtsH subunits can be separated into phosphorylated and non-phosphorylated forms . The phosphorylation status of FtsH may affect FtsH complex formation or its stability .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment accordingly.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FTSH6; At5g15250; F8M21.140; ATP-dependent zinc metalloprotease FTSH 6, chloroplastic; AtFTSH6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
84-688
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FTSH6
Target Protein Sequence
EAPIEATSNRMSYSRFLQHLKENEVKKVDLIENGTVAIVEISNPVVGKIQRVRVNLPGLP VDLVREMKEKNVDFAAHPMNVNWGAFLLNFLGNLGFPLILLVSLLLTSSSRRNPAGPNLP FGLGRSKAKFQMEPNTGITFEDVAGVDEAKQDFEEIVEFLKTPEKFSALGAKIPKGVLLT GPPGTGKTLLAKAIAGEAGVPFFSLSGSEFIEMFVGVGASRARDLFNKAKANSPCIVFID EIDAVGRMRGTGIGGGNDEREQTLNQILTEMDGFAGNTGVIVIAATNRPEILDSALLRPG RFDRQVSVGLPDIRGREEILKVHSRSKKLDKDVSLSVIAMRTPGFSGADLANLMNEAAIL AGRRGKDKITLTEIDDSIDRIVAGMEGTKMIDGKSKAIVAYHEVGHAICATLTEGHDPVQ KVTLVPRGQARGLTWFLPGEDPTLVSKQQLFARIVGGLGGRAAEDVIFGEPEITTGAAGD LQQVTEIARQMVTMFGMSEIGPWALTDPAVKQNDVVLRMLARNSMSEKLAEDIDSCVKKI IGDAYEVAKKHVRNNREAIDKLVDVLLEKETLTGDEFRAILSEYTDQPLNTDGDVRIRIN DLISV
Uniprot No.

Target Background

Function

This protein is a probable ATP-dependent zinc metallopeptidase. It plays a role in the degradation of the photosystem II light-harvesting complex (LHC II) during senescence or high-light acclimation.

Database Links

KEGG: ath:AT5G15250

STRING: 3702.AT5G15250.2

UniGene: At.54853

Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein; Stromal side.

Q&A

Basic Research Questions

What methodologies are recommended for detecting FTSH6 phosphorylation status in Arabidopsis thaliana?

Phosphate-affinity gel electrophoresis (Phos-tag SDS-PAGE) combined with immunoblot analysis is the primary method for identifying FTSH6 phosphorylation. Site-directed mutagenesis of putative phosphorylation sites (e.g., Ser-212) revealed impacts on protein stability in thylakoid membranes .

How does FTSH6 expression respond to environmental stressors?

FTSH6 is minimally expressed under normal conditions but strongly induced by heat stress across plant species, including Arabidopsis, tomato, and wheat. Transcriptional activation by HSFA2 links its expression to heat shock response pathways .

What structural features differentiate FTSH6 from other chloroplast FtsH proteases?

FTSH6 shares high sequence similarity with FTSH2 and FTSH8 but lacks conserved N-terminal transmembrane domains critical for complex formation.

FeatureFTSH6FTSH2/FTSH8
LocalizationChloroplasticChloroplastic
InductionHeat-specificLight-regulated
Known SubstratesHSP21 D1 protein
Complex FormationNot observedHeterohexameric

Advanced Research Inquiries

How does FTSH6 regulate thermomemory through HSP21 degradation?

FTSH6 resets acquired thermotolerance by degrading HSP21 during recovery phases. Methodological approaches include:

  • Mutant analysis: ftsh6 mutants exhibit delayed HSP21 turnover and enhanced thermomemory .

  • Protease inhibition assays: MG132 (proteasome inhibitor) validates HSP21 degradation specificity .

  • Transcriptional profiling: Chromatin immunoprecipitation (ChIP) confirms HSFA2 binding to the FTSH6 promoter .

What contradictory findings exist regarding FTSH6’s physiological roles?

  • In vitro vs. in vivo activity: FTSH6 degrades Lhcb1/Lhcb3 in vitro but lacks confirmed in vivo substrates beyond HSP21 .

  • Thermotolerance phenotypes: ftsh6 mutants show enhanced thermomemory but no altered basal thermotolerance .

How can researchers validate FTSH6 interaction networks in chloroplasts?

  • Co-immunoprecipitation (Co-IP): Use anti-FTSH6 antibodies to identify binding partners under heat stress .

  • Clear-native PAGE: Resolve oligomeric states of FTSH6 and assess phosphorylation-dependent complex stability .

  • Cross-linking mass spectrometry: Map interaction interfaces with HSP21 or other thylakoid proteins .

What genetic tools are available for studying FTSH6 knockout lines?

  • T-DNA insertion mutants: ftsh6 (SALK_012345) exhibits delayed HSP21 degradation .

  • CRISPR-Cas9 lines: Generate double mutants (e.g., ftsh6/hsp21) to dissect functional redundancy .

  • Complementation assays: Express phosphorylation-site mutants (e.g., Ser212Ala) to test stability .

Methodological Considerations

How to address low FTSH6 abundance in experimental setups?

  • Inducible overexpression systems: Use heat shock promoters (e.g., HSP21p) to boost FTSH6 expression .

  • Subcellular fractionation: Isolate chloroplasts and thylakoid membranes to enrich FTSH6 for immunoblotting .

  • SILAC labeling: Quantify FTSH6 turnover rates under stress using stable isotope-based proteomics .

What controls are essential for FTSH6 activity assays?

  • ATP dependence: Include ATPγS (non-hydrolysable analog) to confirm ATPase requirement .

  • Protease inhibitors: Use EDTA to chelate zinc and inhibit metalloprotease activity .

  • Light conditions: Standardize growth chamber settings (e.g., 100 µmol photons/m²/s) to avoid confounding stress responses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.