Recombinant Arabidopsis thaliana ATP-dependent zinc metalloprotease FTSH 8, chloroplastic (FTSH8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
FTSH8; At1g06430; F12K11.22; F12K11_24; ATP-dependent zinc metalloprotease FTSH 8, chloroplastic; AtFTSH8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
74-685
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FTSH8
Target Protein Sequence
DEQGQGVSSSRMSYSRFLEYLDKGRVEKVDLYENGTIAIVEAVSPELGNRIQRVRVQLPG LSQELLQKLRAKNIDFAAHNAQEDQGSPILNLIGNLAFPVILIGGLFLLSRRSSGGMGGP GGPGFPLQIGQSKAKFQMEPNTGVTFDDVAGVDEAKQDFMEVVEFLKKPERFTAVGARIP KGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAP CIVFVDEIDAVGRQRGTGIGGGNDEREQTLNQLLTEMDGFEGNTGVIVVAATNRADILDS ALLRPGRFDRQVSVDVPDVKGRTDILKVHSGNKKFESGVSLEVIAMRTPGFSGADLANLL NEAAILAGRRGKTAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTP GHDAVQKVTLIPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEVIFGESEVT TGAVSDLQQITGLAKQMVTTFGMSEIGPWSLMDSSEQSDVIMRMMARNSMSEKLANDIDT AVKTLSDKAYEIALSQIRNNREAMDKIVEILLEKETMSGDEFRAILSEFTEIPPENRVAS STSTSTPTPASV
Uniprot No.

Target Background

Function
This protein is a component of a complex functioning as an ATP-dependent zinc metallopeptidase. It plays a crucial role in thylakoid formation and the removal of damaged D1 protein in photosystem II, thereby preventing cell death under high-light conditions.
Database Links

KEGG: ath:AT1G06430

STRING: 3702.AT1G06430.1

UniGene: At.17054

Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein; Stromal side.
Tissue Specificity
Expressed in cotyledons, cauline and rosette leaves, stems, sepals, flovers and siliques. Very low in roots.

Q&A

What is the molecular identity of Arabidopsis thaliana FTSH8?

FTSH8 (UniProt ID: Q8W585) is an ATP-dependent zinc metalloprotease located in the chloroplast of Arabidopsis thaliana. The protein is encoded by the FTSH8 gene (At1g06430) and belongs to the AAA+ (ATPases Associated with diverse cellular Activities) protein family. As a chloroplastic precursor, FTSH8 contains domains necessary for both proteolytic activity and protein refolding functions .

The basic protein information is summarized below:

ParameterInformation
UniProt AC / IDQ8W585 / FTSH8_ARATH
Full Protein NameATP-dependent zinc metalloprotease FTSH 8, chloroplastic precursor
Gene NameFTSH8 (OrderedLocusNames: At1g06430)
OrganismArabidopsis thaliana (Mouse-ear cress)
PRO IDPR:Q8W585
Cellular LocalizationChloroplastic

What are the key structural domains of FTSH8 and their functions?

FTSH8 contains two essential functional domains that work in concert to perform its biological activities:

  • AAA Domain: Contains the Walker A motif with a conserved Lys198 residue critical for ATP binding and hydrolysis. This domain provides recognition and specificity for binding substrate proteins and has chaperone-like activity that aids in protein folding .

  • Proteolytic Domain: Contains the conserved HEAGH motif (His417-Glu418-His421) that is responsible for the zinc-dependent proteolytic activity of the enzyme. This domain is crucial for the degradation of misfolded or damaged proteins .

Biochemical analysis has demonstrated that both domains are required for full functionality of FTSH8, and mutations in either domain can significantly impact its biological activity. Specifically, experimental evidence shows that while the AAA domain alone exhibits chaperone-like activity, both ATP hydrolysis and proteolytic functions work concurrently for proper protein refolding and restoration of function .

What is the physiological role of FTSH8 in chloroplast biogenesis?

FTSH8 plays a critical role in chloroplast biogenesis and maintenance, particularly in conjunction with other FTSH family members. Research has revealed that FTSH proteases in chloroplasts function in:

  • Quality control of membrane proteins

  • Degradation of photodamaged proteins, particularly within Photosystem II

  • Protein complex assembly within thylakoid membranes

  • Chloroplast development and maintenance

While single FTSH8 mutants show no obvious phenotypic alterations, double mutants involving FTSH8 and other FTSH genes (particularly FTSH2) reveal striking phenotypes, including albinism, heterotrophy, disruption of flowering, and severely reduced male fertility. This indicates that FTSH8 works redundantly with other FTSH proteins but is essential for chloroplast biogenesis when certain family members are absent .

How does FTSH8 contribute to photosystem II repair and maintenance?

FTSH8 is one of four FTSH proteins (along with FTSH1, FTSH2, and FTSH5) that accumulate in the thylakoid membranes of Arabidopsis chloroplasts. These proteins are organized into two distinct subunit types: Type A (FTSH1, FTSH5) and Type B (FTSH2, FTSH8). Both types are required for complex formation, photosystem II repair, and chloroplast biogenesis .

The presence of both subunit types appears essential for:

  • Formation of functional FTSH complexes in thylakoid membranes

  • Efficient degradation of photodamaged D1 protein in Photosystem II

  • Protection against photoinhibition under high light conditions

  • Maintenance of functional photosynthetic apparatus

What are the optimized approaches for recombinant expression of FTSH8?

Expression of recombinant FTSH8 presents challenges due to its membrane-associated nature and complex structure. Based on current methodologies for similar proteins, the following approaches are recommended:

What methods are effective for functional characterization of recombinant FTSH8?

To assess the dual functionality of recombinant FTSH8 (both proteolysis and chaperone-like activity), the following methodological approaches are recommended:

  • Proteolytic Activity Assays:

    • Zinc-dependent metalloprotease activity can be measured using fluorogenic peptide substrates

    • In vitro degradation assays with known FTSH8 substrates from photosystem II

    • Comparison of wild-type FTSH8 with site-directed mutants of the HEAGH motif (e.g., HEH→AQA substitution)

  • Chaperone Activity Assessment:

    • Protein refolding assays using model substrates or known FTSH8 targets

    • Complementation studies in FTSH8-deficient plant lines

    • ATP hydrolysis assays to correlate ATPase activity with chaperone function

  • Mutagenesis Approaches:

    • Site-directed mutagenesis of key residues, including:

      • K198N mutation in the Walker A motif to disrupt ATP binding

      • H417A/E418Q/H421A mutations in the HEAGH motif to disrupt proteolytic function

How do FTSH protein complexes assemble and what is the specific role of FTSH8 within these complexes?

Research indicates that FTSH proteins in chloroplasts form hetero-oligomeric complexes with specific subunit composition. Advanced investigations into FTSH8's role within these complexes should consider:

  • Complex Composition Analysis:

    • Blue-native PAGE followed by immunodetection to identify native complex sizes

    • Mass spectrometry analysis of co-purified proteins

    • Cross-linking studies to determine subunit arrangement

    • Comparison between wild-type plants and various ftsh mutant combinations

  • Stoichiometry Determination:

    • Evidence suggests that type A (FTSH1, FTSH5) and type B (FTSH2, FTSH8) subunits form complexes in specific ratios

    • Quantitative proteomics can determine the precise stoichiometry

    • Analyzing how disruption of FTSH8 affects complex assembly with remaining subunits

  • Functional Redundancy vs. Specificity:

    • While FTSH8 shows functional redundancy with other type B subunits (particularly FTSH2), the severe phenotypes observed in double mutants suggest specific roles

    • Comparative substrate specificity assays between different FTSH proteins can elucidate unique functions

    • Transcriptional and translational regulation studies under different stress conditions

What are the approaches to resolving contradictions in FTSH8 functional data?

Research on FTSH8 may reveal seemingly contradictory data that requires careful experimental design to resolve:

  • Phenotypic Discrepancies:

    • Single ftsh8 mutants show no obvious phenotype, yet ftsh8 mutations dramatically enhance ftsh2 mutant phenotypes

    • Recommended approach: Generate conditional mutants or inducible silencing systems to study temporal requirements for FTSH8

  • Functional Redundancy Assessment:

    • Quantify the relative contribution of FTSH8 compared to other FTSH proteins

    • Perform rescue experiments with varied expression levels of different FTSH proteins

    • Analyze tissue-specific or developmental stage-specific requirements

  • Substrate Specificity Determination:

    • Identify specific substrates for FTSH8 versus other FTSH proteins using:

      • Comparative proteomics in different mutant backgrounds

      • In vitro substrate preference assays with recombinant proteins

      • Targeted protein-protein interaction studies

How does FTSH8 function connect to stress response mechanisms in plants?

FTSH8, as part of the chloroplast protein quality control system, plays roles in various stress responses that researchers should consider:

  • High Light Stress:

    • FTSH complexes containing FTSH8 are crucial for degrading photodamaged D1 protein

    • Experimental approaches include exposing plants to different light intensities and measuring photoinhibition in wild-type versus ftsh8 mutant backgrounds

    • Analysis of FTSH8 expression and complex formation under varying light conditions

  • Temperature Stress:

    • AAA+ proteases like FTSH8 may have enhanced roles during temperature extremes

    • Compare heat stress response in wild-type and ftsh8 mutant plants

    • Examine changes in substrate specificity or activity under temperature stress conditions

  • Oxidative Stress:

    • Chloroplasts are major sites of reactive oxygen species (ROS) production

    • Investigate FTSH8's role in removing oxidatively damaged proteins

    • Measure ROS accumulation and oxidative damage in ftsh8 mutants versus wild-type plants

What are the evolutionary implications of FTSH gene family diversification in plants?

The presence of multiple FTSH genes in plants (compared to single genes in most bacteria) suggests evolutionary adaptation worthy of investigation:

  • Phylogenetic Analysis:

    • Construct comprehensive phylogenetic trees of FTSH proteins across diverse plant species

    • Compare chloroplastic FTSH proteins (including FTSH8) with mitochondrial and bacterial homologs

    • Identify conserved domains and variable regions that may indicate functional specialization

  • Selection Pressure Analysis:

    • Calculate Ka/Ks ratios for FTSH genes to identify regions under positive or purifying selection

    • Compare selection patterns between subunit types (type A vs. type B) and between different plant lineages

    • Correlate selection patterns with functional domains and known protein interactions

  • Functional Conservation Testing:

    • Perform cross-species complementation experiments with FTSH8 homologs

    • Determine if FTSH8 functions are conserved across plant species with varying photosynthetic adaptations

    • Investigate how FTSH family complexity correlates with plant adaptation to different environmental niches

What emerging technologies could advance our understanding of FTSH8 function?

Several cutting-edge approaches could resolve current knowledge gaps regarding FTSH8:

  • Cryo-Electron Microscopy:

    • Obtain high-resolution structures of FTSH8-containing complexes

    • Visualize conformational changes during substrate binding and processing

    • Map interactions between different subunits within the complex

  • Proximity-Based Proteomics:

    • Use BioID or APEX2 fusions with FTSH8 to identify transient interacting partners

    • Map the dynamic protein interaction landscape in different physiological conditions

    • Identify previously unknown substrates or regulatory proteins

  • CRISPR-Based Approaches:

    • Generate precise mutations in key FTSH8 domains

    • Create conditional knockout systems for temporal control of FTSH8 expression

    • Perform high-throughput screening of potential genetic interactions

How can systems biology approaches integrate FTSH8 function into chloroplast homeostasis networks?

Understanding FTSH8 within the broader context of chloroplast biology requires integrative approaches:

  • Multi-Omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data from ftsh8 mutants

    • Construct predictive models of how FTSH8 perturbation affects chloroplast function

    • Identify regulatory networks connecting FTSH8 to other chloroplast processes

  • Synthetic Biology Applications:

    • Design modified FTSH8 variants with altered substrate specificity

    • Create synthetic circuits for controlled protein quality control in chloroplasts

    • Develop biosensors based on FTSH8 activity to monitor chloroplast stress

  • Computational Modeling:

    • Develop mathematical models of FTSH8 complex assembly and function

    • Simulate how changes in FTSH8 levels affect photosystem II repair cycle kinetics

    • Predict emergent properties of the chloroplast protein quality control system

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.