Recombinant Arabidopsis thaliana ATP synthase subunit a-2 (ATP6-2)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of ATP6-2

ATP6-2 is a mitochondrial-encoded subunit of ATP synthase, a key enzyme in oxidative phosphorylation. The recombinant form includes residues 98–349 of the mature protein (UniProt ID: P92547) fused to an N-terminal His tag for purification .

Key Features:

PropertyDetail
Gene NameATP6-2 (mitochondrial locus: AtMg01170)
Protein Length252 amino acids (98–349aa mature protein)
Molecular FunctionProton channel component of ATP synthase's F<sub>O</sub> sector
IsoformsMitochondrial ATP6-1 and ATP6-2 coexist in A. thaliana
AA SequenceSPLDQFEIVPLIPMHIGNFYFSFTNSSLFMLLTLSFFLLLIHFVTKKGGGNLVPNAWQSL... (full sequence in )

Production and Purification

Recombinant ATP6-2 is expressed in E. coli and purified via affinity chromatography.

Functional Insights from Gene Disruption Studies

Targeted mitochondrial genome editing using mitoTALENs revealed ATP6-2's essential role in A. thaliana:

Key Findings :

  • Gene Deletion: Homoplasmic disruption of mitochondrial ATP6-2 was achieved, confirming its non-redundant role in ATP synthase assembly.

  • Nuclear Pseudogene: The nuclear genome contains a pseudogene (atp6-1), but mitochondrial ATP6-2 is the functional isoform.

  • Promoter Efficiency: The RPS5A promoter drove the most effective mitoTALEN expression for gene disruption.

  • Structural Impact: ATP6-2 deletions caused large mitochondrial genome rearrangements via illegitimate recombination between repeats.

Applications in Research

Recombinant ATP6-2 is primarily used for:

  1. Structural Studies: Mapping proton translocation pathways in ATP synthase .

  2. Functional Assays: Testing ATP synthesis rates in reconstituted proteoliposomes .

  3. Antibody Production: Immunodetection of native ATP6-2 in mitochondrial extracts .

Comparative Analysis with Pathogenic Mutations

While ATP6-2 itself has no known disease associations, studies on analogous human MT-ATP6 mutations (e.g., m.8993T>G) in yeast highlight conserved functional domains:

  • Mutations in subunit a disrupt proton coupling or F<sub>O</sub>-F<sub>1</sub> interactions, reducing ATP synthesis by 30–90% .

  • Yeast revertants of lethal mutations (e.g., aL173R) restore ATP synthase function via second-site suppressors, informing resilience mechanisms .

Limitations and Future Directions

  • Expression Challenges: Bacterial systems lack post-translational modifications present in plant mitochondria .

  • Functional Gaps: The role of ATP6-2 in plant-specific stress responses remains unexplored.

  • Tool Development: Improved mitoTALEN designs could enable precise point mutations for functional domain analysis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ATP6-2; AtMg01170; ATP synthase subunit a-2; F-ATPase protein 6; P6-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
98-349
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATP6-2
Target Protein Sequence
SPLDQFEIVPLIPMHIGNFYFSFTNSSLFMLLTLSFFLLLIHFVTKKGGGNLVPNAWQSL VELLYDFVLNLVKEQIGGLSGNVKQMFFPCILVTFLFLLFCNLQGMIPYSFTVTSHFLIT LALSFSIFIGITIVGFQRHGLHFFSFLLPAGVPLPLAPFLVLLELISYCFRALSLGIRLF ANMMAGHSLVKILSGFAWTMLCMNDIFYFIGALGPLFIVLALTGLELGVAILQAYVFTIL ICIYLNDAINLH
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) synthesizes ATP from ADP using the proton gradient across the mitochondrial membrane, generated by respiratory chain electron transport complexes. F-type ATPases comprise two domains: the extramembranous catalytic F1 domain and the membrane-bound proton channel F0 domain, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via the rotary mechanism of the central stalk subunits. A key component of the proton channel, this subunit likely plays a direct role in proton translocation across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of ATP6-2 in Arabidopsis thaliana?

ATP6-2 (atp6-2) is one of two isoforms of the ATP synthase subunit 6 gene in the mitochondrial genome of Arabidopsis thaliana, with the other being atp6-1. These genes encode essential components of the mitochondrial ATP synthase complex (Complex V) responsible for ATP production. In the Arabidopsis mitochondrial genome, the atp6 gene is uniquely positioned at the border of a repeated sequence that actively participates in recombination . This genomic arrangement has resulted in two distinct copies of the gene with different protein presequences: one with 134 amino acids and another with 96 amino acids from their respective first ATG codons . Despite these different presequences, the mature protein sequences are identical, suggesting functional conservation of the core protein .

The recombination site in Arabidopsis atp6 occurs precisely at the mature protein terminus, which is reminiscent of similar arrangements observed in other plant species. Unlike most plant species where recombinatorial processes are no longer active and divergent genes dominate in different cytoplasms, Arabidopsis maintains active recombination that has created two genes within a single genome .

How does ATP6-2 differ functionally from ATP6-1 in Arabidopsis mitochondria?

ATP6-1 and ATP6-2 in Arabidopsis encode identical mature proteins but differ in their presequences. These preproteins are likely both synthesized in Arabidopsis mitochondria from promoter elements upstream of each copy . The first presequence (in ATP6-1) shows significant conservation with atp6 presequences from other plant species including Nicotiana tabacum, Petunia parodii, Raphanus sativus, and Zea mays, suggesting it represents an ancient arrangement . In contrast, the second presequence (in ATP6-2) shows no similarity to any other atp6 presequence analyzed to date .

Despite these differences in presequences, both genes appear to be transcribed in Arabidopsis mitochondria. The significance of maintaining two different presequences for functionally identical mature proteins remains an area of active investigation, potentially relating to differential regulation, processing efficiency, or evolutionary adaptation .

What methods are effective for targeted disruption of ATP6-2 in Arabidopsis?

Targeted disruption of ATP6-2 in Arabidopsis has been successfully achieved using mitochondria-targeted transcription activator-like effector nucleases (mitoTALENs) . This represents a significant advancement in plant mitochondrial genome engineering, as it allows for stable and heritable targeted gene modification. The methodology involves:

  • Design of mitoTALENs: Constructs are designed to target specific sequences within the ATP6-2 gene.

  • Delivery methods: Two effective approaches include:

    • Nuclear transformation via floral-dip method

    • Crossing with plants already containing mitoTALEN constructs

  • Promoter selection: Among three mitoTALEN promoters tested, the RPS5A promoter demonstrated the highest efficacy for ATP6-2 disruption .

  • TALEN architecture: Conventional mitoTALENs proved more effective than single-molecule mito-compactTALENs for targeting ATP6-2 .

The gene disruptions typically result in large (kilobase-size) deletions, with the remaining sequence ends connecting to distant loci, mostly through illegitimate homologous recombinations between repeats . Following disruption, the mitochondrial genomes can be recovered in a homoplasmic state, confirming complete gene knockout .

How can researchers differentiate between mitochondrial ATP6-2 and nuclear pseudogenes in experimental analyses?

Differentiating between mitochondrial ATP6-2 and nuclear pseudogenes requires a multi-faceted approach:

  • Sequence analysis: Mitochondrial ATP6-2 and nuclear pseudogenes typically show distinct sequence variations. In Arabidopsis, a nuclear pseudogene of atp6-1 exists, but careful sequence analysis can distinguish between the mitochondrial gene and its nuclear counterpart .

  • Organelle isolation: Purification of intact mitochondria followed by nucleic acid extraction ensures that only mitochondrial DNA is analyzed.

  • PCR-based approaches:

    • Organelle-specific primers designed to amplify unique regions

    • Long-range PCR to capture mitochondria-specific genomic contexts

    • Analysis of RNA editing sites which occur in mitochondrial transcripts but not in nuclear pseudogenes

  • Functional complementation: After gene disruption, successful complementation with the mitochondrial gene but not the nuclear pseudogene confirms their functional distinction.

  • Heteroplasmy analysis: Quantitative PCR or next-generation sequencing can determine the ratio of wild-type to modified mitochondrial genomes, which is not applicable to nuclear pseudogenes .

Researchers have successfully confirmed the disruption of mitochondrial ATP6-2 rather than nuclear pseudogenes through these approaches, verifying that it was the mitochondrial gene that was knocked out .

How do ATP6 genes differ between Arabidopsis and other plant species?

ATP6 genes show remarkable diversity in genomic organization across plant species, with Arabidopsis displaying unique characteristics:

Plant SpeciesATP6 Genomic OrganizationRecombination StatusNumber of Presequences
Arabidopsis thalianaBorder of active repeatActive recombinationTwo different presequences (134 and 96 aa)
Raphanus sativusDifferent genomic contextHistorical recombinationSpecies-specific presequence
Oryza sativaDifferent upstream/downstream regionsHistorical recombinationSpecies-specific presequence
Sorghum bicolorDifferent genomic arrangementHistorical recombinationSpecies-specific presequence
Glycine maxUnique flanking regionsHistorical recombinationSpecies-specific presequence
Helianthus annuusDistinct genomic contextHistorical recombinationSpecies-specific presequence
Brassica napusUnique arrangementHistorical recombinationSpecies-specific presequence

The Arabidopsis mitochondrial genome is unique in maintaining active recombination that has created two ATP6 genes within a single genome, whereas in most other plant species, recombinatorial processes are no longer active, and divergent genes dominate in different cytoplasms . The first presequence in ATP6-1 shows significant conservation with other plant species, suggesting an ancient arrangement, while the ATP6-2 presequence is unique and shows no similarity to other known ATP6 presequences .

Despite these variations in genomic organization and presequences, the mature ATP6 protein sequence is highly conserved across species, highlighting its essential role in mitochondrial function .

What parallels exist between Arabidopsis ATP6-2 function and human MT-ATP6-related disorders?

Research on Arabidopsis ATP6-2 provides valuable insights into human MT-ATP6-related disorders due to several functional parallels:

  • Conserved core function: Both Arabidopsis ATP6-2 and human MT-ATP6 encode essential components of mitochondrial ATP synthase (Complex V), with mutations in either disrupting ATP production .

  • Genomic complexity: While Arabidopsis has two ATP6 isoforms with identical mature proteins but different presequences, humans have a single MT-ATP6 gene that can harbor various pathogenic variants .

  • Phenotypic spectrum:

    • Human MT-ATP6 mutations: Associated with conditions ranging from mild symptoms (intellectual disability, depression, migraines) to severe manifestations like Leigh syndrome, a progressive neurodegenerative disease .

    • Arabidopsis ATP6 disruption: Can affect mitochondrial function with consequences for plant development and stress responses .

  • Biomarker parallels: In humans, MT-ATP6 disorders can be detected through specific metabolic signatures, such as low citrulline and/or elevated C5-OH levels . Similar metabolic alterations might be identifiable in Arabidopsis with ATP6 mutations.

  • Heteroplasmy effects: In humans, the severity of MT-ATP6-related disorders correlates with mutation heteroplasmy levels . Arabidopsis research has demonstrated the ability to manipulate homoplasmy/heteroplasmy of mitochondrial mutations, providing a plant model for studying these effects .

Research in Arabidopsis ATP6 biology contributes to understanding conserved mechanisms that may inform therapeutic approaches for human mitochondrial disorders, particularly those affecting ATP synthase function .

How do assembly factors interact with ATP synthase components in Arabidopsis mitochondria?

Assembly of the mitochondrial ATP synthase in Arabidopsis involves specific interactions between assembly factors and ATP synthase subunits:

  • Key assembly factors: Atp11 and Atp12 are critical assembly factors for F-type ATP synthase in Arabidopsis, with their absence being lethal .

  • Specific interactions:

    • Atp11 specifically interacts with the β subunit (ATP2) of the Arabidopsis mitochondrial ATPase

    • Atp12 specifically interacts with the α subunit (ATP1) of the Arabidopsis mitochondrial ATPase

  • Functional conservation: These interaction patterns mirror those observed in Saccharomyces cerevisiae, suggesting evolutionary conservation of assembly mechanisms across eukaryotes .

  • Subcellular localization: Atp12 has been confirmed to localize specifically to mitochondria in Arabidopsis, consistent with its role in mitochondrial ATP synthase assembly .

These assembly factor interactions represent critical steps in the biogenesis of functional ATP synthase complexes. The lethality observed in the absence of Atp11 or Atp12 underscores the essential nature of proper ATP synthase assembly for plant viability . Research in this area contributes to understanding how complex multisubunit enzymes like ATP synthase are assembled in plant mitochondria.

What mechanisms govern RNA editing and processing of ATP6-2 transcripts in Arabidopsis?

RNA editing and processing of ATP6-2 transcripts in Arabidopsis involve several specific mechanisms:

  • Limited RNA editing: In the Arabidopsis atp6 open reading frame, only one RNA editing site is predicted to alter codon 26 from specifying proline to either leucine or serine, consistent with other plants . This represents one of the least edited conserved mRNAs in plant mitochondria observed to date, as Brassicaceae members generally show minimal editing in atp6 transcripts .

  • Protein processing:

    • N-terminal processing: Despite having different presequences, both ATP6-1 and ATP6-2 preproteins undergo N-terminal processing to generate identical mature proteins .

    • C-terminal precision: RNA editing at the carboxy terminus ensures precise protein termination, a feature observed across many plant species .

  • Transcription mechanisms:

    • Both ATP6-1 and ATP6-2 genes appear to be transcribed in Arabidopsis mitochondria

    • The predicted 5'-termini of the respective mRNAs coincide with conserved sequence elements that may function as promoters

  • Conservation significance: The combination of protein processing at the amino terminus and RNA editing at the carboxy terminus appears to be an evolved strategy in plant mitochondria to ensure correct production of this essential protein .

The precise coordination of these mechanisms ensures the accurate expression of ATP6 proteins despite the genomic complexity resulting from recombination events. This represents a sophisticated example of post-transcriptional and post-translational regulation in plant mitochondria.

How can ATP6-2 disruption techniques advance understanding of mitochondrial genome evolution?

ATP6-2 disruption techniques provide powerful tools for investigating mitochondrial genome evolution:

  • Recombination dynamics: The successful deletion of ATP6-2 using mitoTALENs allows researchers to investigate how the mitochondrial genome responds to targeted modifications, potentially revealing mechanisms of genomic rearrangement and repair . This is particularly relevant for ATP6 genes, which are frequently involved in recombination events across plant species .

  • Heteroplasmy resolution: Following ATP6-2 disruption, tracking how the mitochondrial population resolves to homoplasmy provides insights into mitochondrial selection pressures and inheritance mechanisms .

  • Compensatory mechanisms: Analyzing how plants respond to the loss of one ATP6 isoform can reveal redundancy mechanisms and functional adaptations within the mitochondrial genome.

  • Evolutionary constraints: The observation that gene disruptions result in large deletions with connections to distant loci through illegitimate homologous recombinations between repeats provides clues about evolutionary constraints on mitochondrial genome rearrangements .

  • Comparative genomics applications: Applying these techniques across different plant species or ecotypes could reveal lineage-specific differences in mitochondrial genome plasticity and evolution.

These approaches have significant potential to resolve long-standing questions about mitochondrial genome evolution, particularly regarding the forces that shape genomic architecture and the functional consequences of structural variations .

What emerging research directions are being explored for ATP6-2 in plant stress response and energy metabolism?

Several cutting-edge research directions are emerging for ATP6-2 in plant stress response and energy metabolism:

  • Stress-responsive regulation: Investigations into whether ATP6-2 expression or processing is altered under different stress conditions (drought, salinity, temperature extremes) to modulate mitochondrial energy production.

  • Retrograde signaling: Exploring how ATP6-2 function and disruption influence retrograde signaling from mitochondria to the nucleus, potentially affecting nuclear gene expression and whole-plant adaptation.

  • Interaction with alternative oxidase pathways: Research into how ATP6-2 function coordinates with alternative respiratory pathways, particularly under stress conditions when energy demands and reactive oxygen species management are critical.

  • Tissue-specific functions: Investigations of whether ATP6-1 and ATP6-2 show tissue-specific expression patterns or functional differences despite encoding identical mature proteins.

  • Synthetic biology applications: Development of engineered variants of ATP6-2 with altered properties to optimize energy production or stress tolerance in crop plants.

  • Coordination with chloroplast energy production: Studies exploring the crosstalk between mitochondrial ATP production involving ATP6-2 and chloroplast-based energy generation, particularly under fluctuating light conditions or environmental stress.

These research directions hold potential for advancing fundamental understanding of plant energy metabolism while potentially contributing to agricultural applications for improving crop resilience and productivity in changing environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.