Recombinant Arabidopsis thaliana Bax inhibitor 1 (BI-1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Arabidopsis BI-1

BI-1 is an endoplasmic reticulum (ER)-resident transmembrane protein evolutionarily conserved across eukaryotes. It suppresses cell death induced by biotic and abiotic stresses, including pathogen attacks, oxidative stress, and ER stress . Recombinant BI-1 is produced by cloning the AtBI-1 gene into heterologous expression systems (e.g., Escherichia coli, yeast, or transgenic plants) to study its structure-function relationships and regulatory mechanisms .

Biotic Stress Resistance

  • Pathogen Defense: Overexpression of AtBI-1 in transgenic Arabidopsis enhances resistance to Pseudomonas syringae by activating salicylic acid (SA)-dependent defense pathways .

  • Fungal Interactions: Silencing BI-1 increases susceptibility to biotrophic fungi (e.g., Blumeria graminis) but reduces necrotrophic fungal damage .

Abiotic Stress Tolerance

  • Oxidative Stress: AtBI-1 mitigates H₂O₂-induced cell death without altering ROS levels, suggesting a downstream regulatory role .

  • ER Stress: Modulates unfolded protein response (UPR) pathways, delaying ER stress-induced PCD .

Autophagy Regulation

  • Prosurvival vs. Prodeath Roles:

    • BI-1 silencing reduces autophagic activity during Tobacco mosaic virus resistance, exacerbating cell death .

    • Overexpression induces autophagy-dependent cell death under prolonged stress .

Table 1: Experimental Insights from Recombinant BI-1 Studies

Study FocusKey FindingsReferences
SA SignalingAtBI-1 overexpression upregulates PR1 and EDS1, enhancing bacterial resistance
Calcium HomeostasisInteracts with CaM; alters cyclopiazonic acid sensitivity in transgenic plants
PS1 InteractionForms inactive complexes with presenilin-1, unrelated to γ-secretase activity
Autophagy ModulationBinds ATG6 to balance cell survival and death during viral infection

Applications and Future Directions

  • Biotechnology: Engineering crops with recombinant BI-1 could improve resistance to pathogens and environmental stresses .

  • Disease Models: Studying BI-1 interactions with PS1 may clarify its role in neurodegenerative pathways .

  • Metabolic Engineering: Enhancing BI-1-mediated redox homeostasis could mitigate oxidative damage in plants .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs unless otherwise specified. If dry ice shipping is required, please contact us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
BI-1; At5g47120; K14A3.7; Bax inhibitor 1; AtBI-1; BI-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
BI-1
Target Protein Sequence
MDAFSSFFDSQPGSRSWSYDSLKNFRQISPAVQNHLKRVYLTLCCALVASAFGAYLHVLW NIGGILTTIGCIGTMIWLLSCPPYEHQKRLSLLFVSAVLEGASVGPLIKVAIDVDPSILI TAFVGTAIAFVCFSAAAMLARRREYLYLGGLLSSGLSMLMWLQFASSIFGGSASIFKFEL YFGLLIFVGYMVVDTQEIIEKAHLGDMDYVKHSLTLFTDFVAVFVRILIIMLKNSADKEE KKKKRRN
Uniprot No.

Target Background

Function
Bax inhibitor 1 (BI-1) is a suppressor of apoptosis and a modulator of endoplasmic reticulum stress-mediated programmed cell death. It plays a role in methyl jasmonate-induced leaf senescence by regulating cytoplasmic calcium levels.
Gene References Into Functions
  1. BI-1 influences cell death-associated components localized in sphingolipid-enriched microdomains of the plasma membrane. PMID: 26297139
  2. AtBI-1 contributes to the synthesis of sphingolipids during cold stress by interacting with AtSLD1, AtFAH1, AtSBH2, and AtADS2. PMID: 24687220
  3. Arabidopsis thaliana BI-1-interacting proteins have been identified. PMID: 23782494
  4. Overexpression of AtBI-1 increases the amount of 2-hydroxy fatty acids. PMID: 19054355
  5. BAX INHIBITOR 1 acts as an attenuator for cell death progression triggered by both biotic and abiotic types of cell death signals in Arabidopsis. PMID: 16507080
  6. The expression of AtBI-1, which suppresses Bax-induced cell death, in the tapetum at the tetrad stage inhibits tapetum degeneration and subsequently results in pollen abortion, while activation of AtBI-1 at a later stage does not. PMID: 16565524
  7. A study has been conducted to evaluate the effect of AtBI-1 on calcium homeostasis. PMID: 17142482
  8. BI-1 requires normal electron transport activity to suppress cell death in yeast. PMID: 17825821
  9. Findings indicate that the loss of calmodulin binding reduces the cell death suppressor activity of Bax inhibitor-1 in planta. PMID: 19674971

Show More

Hide All

Database Links

KEGG: ath:AT5G47120

STRING: 3702.AT5G47120.1

UniGene: At.24669

Protein Families
BI1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in root tips, root vasculature, flower tissues, including stamens and sepals, and in the base of siliques. Not detected in mature leaves.

Q&A

What is Arabidopsis thaliana Bax Inhibitor 1 and what is its primary function?

Arabidopsis thaliana Bax Inhibitor 1 (AtBI-1) is an evolutionarily-conserved endoplasmic reticulum protein that functions primarily as a suppressor of apoptosis induced by Bax, a pro-apoptotic member of the Bcl-2 family . AtBI-1 was identified as being identical to a previously isolated human gene of unknown function called TEGT (testis enhanced gene transcript) . The protein plays a critical role in the regulation of programmed cell death (PCD) in plants, functioning as an attenuator for cell death progression triggered by both biotic and abiotic stress signals . AtBI-1 is part of a conserved mechanism that appears to have been evolutionarily maintained across different kingdoms, including plants, animals, and fungi .

How does AtBI-1 expression change under stress conditions?

AtBI-1 expression demonstrates significant plasticity in response to various stress conditions. Research has shown that AtBI-1 mRNA is rapidly up-regulated in plants during wounding or pathogen challenge, suggesting its role in stress response pathways . Specifically, when wild-type plants are exposed to PCD-inducing signals such as fungal toxin fumonisin B1 (FB1) or heat shock, AtBI-1 expression increases prior to the activation of cell death, indicating that elevated AtBI-1 expression is important for the basal suppression of cell death progression . Furthermore, accumulation of the AtBI-1 transcript is significantly delayed in coi1 plants, suggesting that reduced AtBI-1 mRNA levels may contribute to the enhanced susceptibility exhibited by these plants to infection by various fungal pathogens .

What cellular pathways is AtBI-1 associated with?

AtBI-1 is associated with multiple cellular pathways and mechanisms:

  • Calcium regulation: AtBI-1 has been shown to be associated with calcium (Ca²⁺) levels in the cell .

  • Reactive oxygen species (ROS) modulation: The protein influences ROS production, which is a key component of stress signaling .

  • Cytosolic acidification: AtBI-1 impacts cellular pH regulation .

  • Autophagy regulation: The protein is linked to autophagy processes, another form of programmed cell death .

  • Endoplasmic reticulum (ER) stress signaling: AtBI-1 participates in ER stress response pathways .

  • Sphingolipid metabolism: In Arabidopsis, AtBI-1 interacts with sphingolipid fatty acid 2-hydroxylase (AtFAH1) via cytochrome b in the ER and requires AtFAH1 to suppress cell death .

What are effective approaches for producing recombinant AtBI-1?

When producing recombinant AtBI-1 for research purposes, several methodological approaches have proven effective:

Expression Systems and Vector Design:

  • Plant-based expression: Use cauliflower mosaic virus 35S promoter for constitutive expression in plant systems, as demonstrated in studies where AtBI-1 was tagged with green fluorescent protein (GFP) .

  • Yeast expression systems: Heterologous expression in yeast has been successfully employed to study AtBI-1 function, particularly in assessing its ability to suppress Bax-induced cell death .

Tagging Strategies:
GFP tagging of AtBI-1 has been validated functionally - research has confirmed that AtBI-GFP retains cell-death suppression activity while allowing subcellular localization studies . This approach revealed that AtBI-GFP localizes to perinuclear regions and reticulate patterns consistent with ER localization .

Purification Considerations:
When working with AtBI-1, consider its membrane-bound nature in the ER, which may require detergent-based extraction methods. Maintaining protein stability and native conformation is crucial for functional studies.

How can researchers effectively assess AtBI-1 function in cell death suppression?

The following experimental approaches can be used to assess AtBI-1 function in suppressing cell death:

Transgenic Plant Systems:

  • Generate transgenic Arabidopsis plants overexpressing Bax protein under an inducible promoter system (such as DEX-inducible) .

  • Create double transgenic lines expressing both Bax and AtBI-1 by retransforming Bax-expressing plants .

  • Induce Bax expression through DEX treatment and assess phenotypic differences between plants expressing only Bax versus those expressing both Bax and AtBI-1 .

Quantitative Assessments:

  • Cell viability assays: Measure cell death progression using vital stains or biochemical markers.

  • Chlorophyll content measurement: As demonstrated in studies, chlorophyll quantification provides a reliable measure of cell death-induced leaf discoloration .

  • Membrane integrity assessment: Evaluate membranous destruction as an indicator of apoptotic phenotypes .

Molecular Markers:

  • Monitor expression of PCD-related genes before and after stress treatments.

  • Assess cytochrome c release or caspase-like activities as indicators of apoptotic progression.

What model systems are appropriate for studying AtBI-1 function?

Several model systems have proven valuable for investigating AtBI-1 function:

In Planta Systems:

  • Arabidopsis thaliana: The native host provides the most relevant genetic background for studying AtBI-1 function. The availability of T-DNA insertion mutants such as atbi1-1 and atbi1-2 facilitates loss-of-function studies .

  • Transgenic tobacco BY2 cells: This cell culture system has been used to visualize AtBI-GFP localization and study its role during cell division .

Heterologous Systems:

  • Yeast: Expression of AtBI-1 in yeast has been used to assess its ability to suppress Bax-induced cell death, providing a simplified eukaryotic system .

  • Fungal models: Studies in the entomopathogenic fungus Metarhizium robertsii have revealed that BI-1 orthologs function in stress response and development across different kingdoms .

Comparative Approaches:
Studying BI-1 function across different organisms (plants, fungi, mammals) has provided insights into evolutionarily conserved mechanisms of cell death regulation .

How does AtBI-1 suppress Bax-induced cell death at the molecular level?

The molecular mechanisms through which AtBI-1 suppresses Bax-induced cell death involve several aspects:

Subcellular Localization and Action:
AtBI-1 primarily localizes to the endoplasmic reticulum (ER), appearing in perinuclear and reticulate patterns in the cell . This is distinct from Bax, which typically targets mitochondria, suggesting an indirect mechanism of suppression rather than direct interaction .

Potential Cross-Talk Mechanisms:
The discrepancy in intracellular localization between AtBI-1 (ER) and Bax (mitochondria) implies the existence of at least one intermediary factor mediating cross-talk between these proteins . Research suggests that AtBI-1 might function through ER stress signaling pathways rather than classical mitochondrium-dependent pathways .

Protein Interactions:
In Arabidopsis, AtBI-1 interacts with sphingolipid fatty acid 2-hydroxylase (AtFAH1) via cytochrome b in the ER and requires this interaction to suppress cell death . This suggests that lipid metabolism plays a role in AtBI-1's anti-apoptotic function.

Calcium Homeostasis:
AtBI-1 may alter ER ionic homeostasis, similar to how the animal anti-apoptotic protein Bcl-2 functions . Regulation of calcium flux across the ER membrane could be one mechanism by which AtBI-1 modulates cell death signaling.

What phenotypes are observed in AtBI-1 knockout/mutant plants?

AtBI-1 knockout or mutant plants exhibit several distinctive phenotypes that reveal the protein's function:

Normal Growth Under Standard Conditions:
Under normal growth conditions, Arabidopsis mutants with T-DNA insertions in the AtBI1 gene (atbi1-1 with a C-terminal missense mutation and atbi1-2, a gene knockout) are phenotypically indistinguishable from wild-type plants .

  • Accelerated progression of cell death upon infiltration of leaf tissues with the programmed cell death-inducing fungal toxin fumonisin B1 (FB1) .

  • Increased sensitivity to heat shock-induced cell death .

Rescue by Complementation:
Over-expression of the AtBI1 transgene in these homozygous mutant backgrounds rescues the accelerated cell death phenotypes, confirming that the observed phenotypes are specifically due to loss of AtBI-1 function .

What are the key differences between plant and animal BI-1 functions?

While BI-1 proteins are highly conserved across eukaryotes, there are several important distinctions between plant and animal BI-1 functions:

Structural and Functional Conservation:
Both plant and animal BI-1 proteins suppress cell death, suggesting evolutionary conservation of this core function . Plant BI-1 homologues (from oilseed rape, tobacco, rice, and Arabidopsis) can inhibit cell death induced by Bax in human embryonic kidney 293 cells and yeast, demonstrating functional conservation across kingdoms .

Signaling Pathways:

  • In animals, BI-1 often works in conjunction with Bcl-2 family proteins, which have no direct homologs in plants .

  • Plant BI-1 appears to be more directly involved in pathogen response and wound signaling pathways .

Response to Stimuli:

  • Plant BI-1 expression is rapidly up-regulated during wounding or pathogen challenge .

  • Plant BI-1 function is integrated with jasmonate signaling, as evidenced by delayed accumulation of AtBI-1, transcript in coi1 plants .

Interaction Partners:

  • Plant-specific interactions such as that between AtBI-1 and sphingolipid fatty acid 2-hydroxylase (AtFAH1) suggest unique adaptations of BI-1 function in plants .

How can researchers investigate the cross-talk between AtBI-1 and other cell death regulators?

Investigating the cross-talk between AtBI-1 and other cell death regulators requires sophisticated experimental approaches:

Interactome Analysis:

  • Proximity-based labeling: Techniques such as BioID or APEX can identify proteins in close proximity to AtBI-1 in the ER membrane.

  • Co-immunoprecipitation coupled with mass spectrometry: This approach can identify protein complexes containing AtBI-1 under different stress conditions.

  • Split-fluorescent protein assays: These can visualize interactions in living cells, particularly important for membrane-bound proteins like AtBI-1.

Genetic Interaction Studies:

  • Generate double and triple mutants combining atbi1 mutations with mutations in genes involved in various cell death pathways.

  • Use CRISPR/Cas9 to create conditional knockouts that allow temporal control of gene expression.

  • Employ synthetic genetic array analysis to systematically identify genetic interactions.

Signaling Pathway Dissection:

  • Calcium imaging: Using genetically encoded calcium indicators to monitor how AtBI-1 affects calcium flux during stress responses.

  • ROS detection: Employ fluorescent probes to track changes in reactive oxygen species production in atbi1 mutants compared to wild-type.

  • Transcriptome analysis: Compare gene expression patterns in wild-type and atbi1 mutants under various stress conditions to identify downstream effectors.

What are the methodological challenges in studying AtBI-1 localization and dynamics in plant cells?

Research on AtBI-1 localization and dynamics faces several methodological challenges:

Membrane Protein Visualization:

  • AtBI-1 is an ER membrane protein, which can complicate imaging due to the dynamic and extensive nature of the ER network .

  • Super-resolution microscopy techniques may be needed to distinguish between different ER domains where AtBI-1 might be functioning.

Real-time Tracking During Stress:

  • Capturing the dynamics of AtBI-1 localization during stress responses requires live-cell imaging setups capable of applying stress treatments while maintaining imaging conditions.

  • Photobleaching of fluorescent tags during long-term imaging can limit observation periods.

Distinguishing Functional Pools:

  • Different pools of AtBI-1 might exist within the ER, potentially with distinct functions.

  • Spatial resolution techniques such as FRET-FLIM (Fluorescence Resonance Energy Transfer-Fluorescence Lifetime Imaging) can help determine if AtBI-1 forms complexes with different partners in distinct ER domains.

Potential Solutions:

  • Employ photoconvertible fluorescent proteins to track specific pools of AtBI-1 over time.

  • Use correlative light and electron microscopy to combine dynamic observations with high-resolution structural information.

  • Develop split fluorescent protein systems specific for plant ER membranes to visualize protein-protein interactions in situ.

How does AtBI-1 function integrate with plant-specific stress response pathways?

The integration of AtBI-1 function with plant-specific stress response pathways represents an important area for advanced research:

Pathogen Response Integration:

  • AtBI-1 expression is rapidly up-regulated during pathogen challenge, and this response is affected in jasmonate signaling mutants (coi1) .

  • Future research should investigate how AtBI-1 coordinates with pattern recognition receptors and R-gene-mediated defense responses.

Hormone Signaling Networks:

  • The delayed accumulation of AtBI-1 transcript in coi1 plants suggests integration with jasmonate signaling .

  • Further studies should explore connections with other defense hormones like salicylic acid, ethylene, and abscisic acid.

Abiotic Stress Integration:

  • AtBI-1 mutants show increased sensitivity to heat shock-induced cell death .

  • Research is needed to determine how AtBI-1 interfaces with heat shock proteins and other abiotic stress response factors.

Sphingolipid Metabolism Connection:

  • AtBI-1 interacts with sphingolipid fatty acid 2-hydroxylase (AtFAH1) .

  • Further investigation of how sphingolipid composition affects stress responses and cell death regulation could reveal important mechanistic insights.

What protein-protein interactions of AtBI-1 have been experimentally validated?

The following table summarizes key protein-protein interactions of AtBI-1 that have been experimentally validated:

Interaction PartnerExperimental MethodCellular LocalizationFunctional SignificanceReference
AtFAH1 (sphingolipid fatty acid 2-hydroxylase)Not specified in sourcesEndoplasmic reticulumRequired for AtBI-1 to suppress cell death
Cytochrome bNot specified in sourcesEndoplasmic reticulumMediates interaction with AtFAH1
BaxGenetic interaction (no direct physical interaction demonstrated)AtBI-1 in ER, Bax primarily in mitochondriaAtBI-1 suppresses Bax-induced cell death despite different localizations

This limited set of validated interactions suggests that further proteomics studies are needed to fully characterize the AtBI-1 interactome, particularly under different stress conditions.

How conserved is the BI-1 protein structure and function across different organisms?

BI-1 shows remarkable conservation across different organisms, though with some key differences:

Sequence and Structural Conservation:
BI-1 is an evolutionarily-conserved protein found in diverse organisms including mammals, plants, fungi, and even some bacteria . While sequence identity percentages between distant organisms aren't provided in the search results, the functional conservation suggests significant structural similarity.

Functional Conservation:

  • Plant BI-1 homologs from oilseed rape and tobacco can inhibit Bax-induced apoptosis when co-transfected in human embryonic kidney 293 cells .

  • Plant BI-1 homologs from rice and Arabidopsis inhibit Bax-induced cell death in yeast .

  • The fungal BI-1 ortholog MrBI-1 from Metarhizium robertsii can partially rescue mammalian Bax-induced cell death in yeast .

Cross-Kingdom Differences:

  • Unlike in yeasts and plants, expression of mammalian Bax did not lead to a lethal effect in the fungus Metarhizium robertsii, although it did aggravate the fungal apoptotic effect of farnesol .

  • BI-1 in fungi like M. robertsii contributes to antiapoptotic-like cell death via the ER stress-signaling pathway rather than the classical mitochondrium-dependent pathway .

What contradictory findings exist in the literature regarding AtBI-1 function?

While the search results don't explicitly highlight contradictory findings about AtBI-1 function, they do mention some inconsistencies in BI-1 research more broadly:

Inconsistent Roles in Disease Conditions:
The roles of BI-1 in various disease conditions are not fully consistent among studies . This suggests that BI-1 function may be context-dependent or influenced by additional factors not yet identified.

Mechanism of Action Discrepancies:
The molecular mechanisms of BI-1 have not been directly explained with regard to how various conditions can be regulated . This gap in understanding contributes to seemingly contradictory observations about BI-1 function in different experimental systems.

Cross-Kingdom Functional Discrepancies:
Unlike observations in yeasts and plants, expression of mammalian Bax did not lead to a lethal effect in the fungus M. robertsii . This suggests that while BI-1 function is broadly conserved, the cellular context and additional factors influence its precise role in different organisms.

Future Research Directions:
To resolve these apparent contradictions, further research should focus on:

  • Systematic comparison of BI-1 function across different model organisms under identical stress conditions

  • Identification of organism-specific interaction partners

  • Detailed structural analysis to identify conserved and variable domains that might explain functional differences

What are common challenges in expressing and purifying recombinant AtBI-1?

Researchers working with recombinant AtBI-1 may encounter several technical challenges:

Expression Challenges:

  • Membrane protein expression: As an ER membrane protein, AtBI-1 may face folding issues when overexpressed, potentially forming inclusion bodies.

  • Toxicity issues: Overexpression of proteins involved in cell death regulation like AtBI-1 might affect host cell viability.

  • Expression level optimization: Finding the right balance between sufficient expression and maintaining protein functionality.

Purification Considerations:

  • Detergent selection: Choosing appropriate detergents for solubilization that maintain protein structure and function is critical.

  • Maintaining native conformation: Preserving the native fold of AtBI-1 during extraction and purification is essential for functional studies.

  • Tag interference: Ensuring that tags used for purification (His, GST, etc.) don't interfere with function, as demonstrated with GFP tagging which retained functionality .

Quality Control:

  • Assessing proper folding: Developing assays to confirm that recombinant AtBI-1 retains its native structure.

  • Functional validation: Establishing cell-based assays to confirm that purified AtBI-1 retains its anti-apoptotic activity.

How can researchers address variability in stress response experiments involving AtBI-1?

Stress response experiments with AtBI-1 may show variability due to multiple factors:

Standardization Approaches:

  • Environmental control: Strictly control growth conditions (light, temperature, humidity) prior to and during stress treatments.

  • Developmental staging: Use plants at precisely defined developmental stages since stress responses can vary with plant age.

  • Treatment standardization: Develop consistent methods for applying stressors (e.g., precise concentration of fumonisin B1, exact heat shock parameters) .

Experimental Design Considerations:

  • Biological replicates: Use sufficient biological replicates (minimum n=3, ideally n≥5) to account for natural variation.

  • Technical replicates: Include multiple technical replicates for each measurement.

  • Time-course analysis: Rather than single time-point measurements, track responses over time to capture the full dynamics of AtBI-1 involvement.

Quantitative Assessments:

  • Multiple readouts: Use several independent methods to assess cell death (e.g., vital stains, chlorophyll content, electrolyte leakage) .

  • Molecular markers: Include gene expression analysis of known stress response genes as internal controls.

  • Statistical approaches: Apply appropriate statistical methods that account for the typically non-normal distribution of stress response data.

What controls are essential for studies examining AtBI-1's role in programmed cell death?

Proper controls are crucial for studies investigating AtBI-1's role in programmed cell death:

Genetic Controls:

  • Wild-type comparison: Always include wild-type plants/cells grown under identical conditions.

  • Complementation lines: Create AtBI-1 complementation lines in mutant backgrounds to confirm phenotypes are specifically due to loss of AtBI-1 .

  • Multiple mutant alleles: Use different mutant alleles (e.g., atbi1-1 and atbi1-2) to confirm consistent phenotypes .

Treatment Controls:

  • Vehicle controls: Include appropriate vehicle controls for chemical treatments (e.g., solvent-only control for fumonisin B1).

  • Intensity gradient: Apply stressors at different intensities to determine response thresholds.

  • Positive controls: Include known inducers of programmed cell death with well-characterized responses.

Molecular Controls:

  • Expression verification: Confirm AtBI-1 expression levels in transgenic lines by RT-PCR and/or Western blotting.

  • Localization confirmation: For tagged versions like AtBI-GFP, verify proper localization to the ER .

  • Functional validation: Confirm that tagged or modified versions retain cell death suppression activity, as was done with AtBI-GFP .

What emerging technologies could advance our understanding of AtBI-1 function?

Several emerging technologies offer promising avenues for advancing AtBI-1 research:

Advanced Imaging Techniques:

  • Super-resolution microscopy: Technologies like STORM, PALM, or STED could reveal the precise nanoscale organization of AtBI-1 within the ER membrane.

  • Live-cell calcium imaging: Using genetically encoded calcium indicators with high temporal resolution could help understand how AtBI-1 regulates calcium homeostasis during stress.

  • Correlative light and electron microscopy (CLEM): This could connect AtBI-1 dynamics with ultrastructural changes in the ER during stress responses.

Genome Editing Approaches:

  • CRISPR-Cas9 base editing: Creating precise point mutations in AtBI-1 to identify critical residues for function.

  • Optogenetic control of AtBI-1: Developing light-controlled versions of AtBI-1 to manipulate its activity with spatial and temporal precision.

  • Conditional expression systems: Creating inducible knockouts or overexpression lines to study AtBI-1 function at specific developmental stages.

Structural Biology Methods:

  • Cryo-electron microscopy: Determining the structure of AtBI-1 in its native membrane environment.

  • Hydrogen-deuterium exchange mass spectrometry: Identifying dynamic regions and conformational changes in AtBI-1 during stress.

  • In-cell NMR: Studying AtBI-1 structural dynamics in living cells.

What are the most promising directions for translational research involving AtBI-1?

Translational research involving AtBI-1 could focus on several promising directions:

Crop Improvement Strategies:

  • Enhanced stress tolerance: Engineering crops with optimized AtBI-1 expression could potentially improve resilience to environmental stresses like heat shock .

  • Disease resistance: Given AtBI-1's role in pathogen response, modulating its expression might enhance resistance to fungal pathogens .

  • Post-harvest longevity: Controlling programmed cell death pathways could potentially extend shelf life of agricultural products.

Biotechnological Applications:

  • Cell death sensors: Developing biosensors based on AtBI-1 interaction dynamics to detect stress conditions in plants.

  • Heterologous expression systems: Exploiting AtBI-1's cell death suppression capabilities to improve protein production in plant-based biofactories.

Comparative Medicine Insights:

  • Cross-kingdom conservation: The high conservation of BI-1 across kingdoms suggests that discoveries in plant BI-1 research might inform understanding of BI-1 function in human diseases .

  • Novel therapeutic targets: Understanding how BI-1 regulates cell death across different organisms could reveal new intervention points for diseases involving dysregulated apoptosis.

How might AtBI-1 research contribute to understanding broader questions in plant stress biology?

AtBI-1 research has potential to advance our understanding of fundamental questions in plant stress biology:

Integration of Stress Signaling Networks:

  • AtBI-1's involvement in both biotic and abiotic stress responses provides an opportunity to study how plants integrate different stress signals .

  • Research could reveal how endoplasmic reticulum stress connects to other cellular stress response pathways.

Evolution of Cell Death Mechanisms:

  • The conservation of BI-1 across kingdoms offers insights into the evolution of programmed cell death mechanisms .

  • Comparative studies across plant species could reveal how cell death regulation has adapted to different ecological niches.

Cellular Decision-Making:

  • AtBI-1 functions as an attenuator rather than a complete inhibitor of cell death , raising questions about how cells determine the threshold between survival and death.

  • Understanding this decision point could help explain how plants balance growth and defense under resource-limited conditions.

Stress Memory and Priming:

  • Investigation of whether prior activation of AtBI-1 influences responses to subsequent stress could provide insights into stress memory mechanisms.

  • This could connect to broader questions about epigenetic regulation of stress responses in plants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.