Recombinant Arabidopsis thaliana Beta-carotene 3-hydroxylase 1, chloroplastic (BETA-OHASE 1)

Shipped with Ice Packs
In Stock

Description

Protein Overview

BETA-OHASE 1 (UniProt ID: Q9SZZ8) catalyzes the hydroxylation of β-carotene to produce zeaxanthin, a key xanthophyll involved in photoprotection. The recombinant version consists of amino acids 52-310 from the full-length Arabidopsis thaliana enzyme, fused with an N-terminal His-tag for purification convenience .

Catalytic Activity:

β-carotene+O2+2 ferredoxinredzeaxanthin+2 ferredoxinox+H2O\text{β-carotene} + O_2 + 2 \text{ ferredoxin}_{red} \rightarrow \text{zeaxanthin} + 2 \text{ ferredoxin}_{ox} + H_2O

This reaction requires molecular oxygen and reduced ferredoxin as cofactors .

Biological Impact:

  • Photoprotection: Zeaxanthin quenches singlet oxygen (1O2^1O_2) generated under high light stress

  • PSI Stability: β-carotene derivatives stabilize Photosystem I reaction centers

  • Abiotic Stress Response: Mutants lacking functional BETA-OHASE 1 show increased photooxidative damage at low temperatures

In Vitro Enzyme Kinetics

Studies using recombinant BETA-OHASE 1 have revealed:

  • Substrate specificity for β-carotene over α-carotene

  • Optimal activity at pH 7.5 with 25°C incubation

  • Inhibition by diphenylamine (IC₅₀ = 12 μM)

Mutant Phenotype Analysis

The Arabidopsis szl1 mutant (defective in lycopene β-cyclase) demonstrated:

ParameterWild Typeszl1 Mutant
β-carotene levels100%42%
PSI Damage (8°C)15%68%
Chlorosis Onset14 days7 days

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BETA-OHASE; 1; B1; CHY1; At4g25700; L73G19.80; Beta-carotene 3-hydroxylase 1, chloroplastic; AtB1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
52-310
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
BETA-OHASE
Target Protein Sequence
EERRQNSPIENDERPESTSSTNAIDAEYLALRLAEKLERKKSERSTYLIAAMLSSFGITS MAVMAVYYRFSWQMEGGEISMLEMFGTFALSVGAAVGMEFWARWAHRALWHASLWNMHES HHKPREGPFELNDVFAIVNAGPAIGLLSYGFFNKGLVPGLCFGAGLGITVFGIAYMFVHD GLVHKRFPVGPIADVPYLRKVAAAHQLHHTDKFNGVPYGLFLGPKELEEVGGNEELDKEI SRRIKSYKKASGSGSSSSS
Uniprot No.

Target Background

Function

Recombinant Arabidopsis thaliana Beta-carotene 3-hydroxylase 1, chloroplastic (BETA-OHASE 1) is a non-heme diiron monooxygenase involved in xanthophyll biosynthesis. It specifically catalyzes beta-ring hydroxylation of beta-carotene. It exhibits low activity towards the beta- and epsilon-rings of alpha-carotene but shows no activity with acyclic carotenoids such as lycopene and neurosporene. Ferredoxin serves as its electron donor.

Database Links

KEGG: ath:AT4G25700

STRING: 3702.AT4G25700.1

UniGene: At.3355

Protein Families
Sterol desaturase family
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in leaves, flowers, stems, roots and siliques.

Q&A

What is the primary function of BETA-OHASE 1 in Arabidopsis thaliana?

BETA-OHASE 1 (also referred to as B1 locus) is one of the nonheme diiron β-ring monooxygenases in Arabidopsis that primarily catalyzes the hydroxylation of β-rings in β,β-carotenoids. This enzyme plays a crucial role in the carotenoid biosynthetic pathway by converting β-carotene derivatives to their hydroxylated forms. The enzyme shows specificity toward the β-rings of β,β-carotenoids, facilitating the synthesis of xanthophylls such as zeaxanthin from β-carotene . The hydroxylation reaction introduces hydroxyl groups at the C-3 position of the β-ring, which is an essential step in the diversification of carotenoids in plant tissues.

How does BETA-OHASE 1 differ from other carotenoid hydroxylases in Arabidopsis?

Arabidopsis thaliana contains at least four distinct carotenoid hydroxylases: two nonheme diiron β-ring monooxygenases (BETA-OHASE 1/B1 and BETA-OHASE 2/B2), and two cytochrome P450-type hydroxylases (CYP97A3/LUT5 and CYP97C1/LUT1) . The primary distinction lies in their substrate specificity and cellular localization. BETA-OHASE 1, like BETA-OHASE 2, preferentially hydroxylates the β-rings of β,β-carotenoids, while CYP97A3 has major activity toward the β-ring of α-carotene (β,ε-carotene) and minor activity on β-carotene. CYP97C1 specifically hydroxylates the ε-ring of β,ε-carotenoids . These functional differences create a complex network of partially redundant yet specialized enzymes that together regulate carotenoid composition in plant tissues.

What is the subcellular localization of BETA-OHASE 1?

BETA-OHASE 1 is localized in the chloroplast, as indicated by its full name (Beta-carotene 3-hydroxylase 1, chloroplastic). This localization is consistent with its function in carotenoid biosynthesis, which primarily occurs in plastids. The chloroplastic localization can be confirmed experimentally using GFP fusion proteins and confocal microscopy. Similar to other plant carotenoid hydroxylases like GmBCH2 and GmBCH3 in soybean, BETA-OHASE 1 is targeted to plastids where it can access its carotenoid substrates . This plastidial localization is critical for its biological function, as carotenoids are synthesized in these organelles.

What are the expression patterns of BETA-OHASE 1 in different tissues?

BETA-OHASE 1 is expressed in multiple tissues in Arabidopsis, with highest expression typically found in photosynthetic tissues where carotenoid biosynthesis is most active. Similar to the pattern observed with homologous genes in soybean (such as GmBCH2), expression levels may vary across different developmental stages and in response to environmental stimuli . While specific expression data for BETA-OHASE 1 is not detailed in the search results, studies of related genes in soybean showed that expression patterns can be tissue-specific, with some hydroxylases showing higher expression in leaves (like GmBCH2) and others having more distributed expression across different tissues (like GmBCH1 and GmBCH3) .

How can BETA-OHASE 1 be functionally characterized in heterologous expression systems?

Functional characterization of BETA-OHASE 1 can be performed using Escherichia coli engineered to produce β-carotene. The methodology involves several key steps:

  • Clone the full-length BETA-OHASE 1 cDNA into an expression vector (e.g., pUC19).

  • Transform E. coli cells carrying a plasmid for β-carotene production (e.g., pACCAR16ΔcrtX) with the BETA-OHASE 1 expression construct.

  • Induce expression and culture the transformed bacteria.

  • Extract carotenoids using organic solvents and analyze by HPLC.

  • Confirm the identity of hydroxylated products (β-cryptoxanthin and zeaxanthin) by:

    • Comparing retention times with standards

    • Analyzing absorption spectra

    • Performing liquid chromatography/mass spectrometry to determine molecular masses

Successful conversion of β-carotene to β-cryptoxanthin and zeaxanthin would confirm the β-ring hydroxylase activity of BETA-OHASE 1, as demonstrated with similar enzymes like GmBCH1 and GmBCH2 from soybean .

What approaches can be used to study functional redundancy between BETA-OHASE 1 and other carotenoid hydroxylases?

Investigating functional redundancy requires a systematic approach:

  • Generate single and combined knockout/knockdown mutants of BETA-OHASE 1 and other hydroxylases:

    • T-DNA insertion mutants

    • CRISPR/Cas9-generated knockout lines

    • RNA interference (RNAi) lines for targeted gene silencing

  • Analyze carotenoid profiles in mutant lines compared to wild type:

    • HPLC analysis of leaf tissue from 5-week-old plants

    • Quantification of specific carotenoids (β-carotene, β,β-xanthophylls, lutein)

  • Perform complementation studies:

    • Express BETA-OHASE 1 in multiple hydroxylase mutant backgrounds

    • Quantify restoration of wild-type carotenoid profiles

Research with related hydroxylases has shown that b1b2 double-null mutants (lacking both nonheme β-ring hydroxylases) reduce β,β-carotene-derived xanthophyll levels by 80%, while lutein levels slightly increase . This indicates partial functional independence between the two carotenoid biosynthesis branches and suggests that other hydroxylases (like CYP97A3) cannot fully compensate for the loss of BETA-OHASE 1 and 2 in β,β-carotenoid hydroxylation .

How does substrate channeling affect BETA-OHASE 1 activity in the carotenoid biosynthetic pathway?

Substrate channeling in carotenoid biosynthesis involves the directed movement of intermediates between enzymes in a metabolic pathway without free diffusion. For BETA-OHASE 1, substrate channeling research requires:

  • Investigation of protein-protein interactions:

    • Yeast two-hybrid assays to identify interaction partners

    • Co-immunoprecipitation experiments with carotenoid biosynthetic enzymes

    • Bimolecular fluorescence complementation to visualize interactions in vivo

  • Kinetic analysis of sequential reactions:

    • Purification of recombinant BETA-OHASE 1 and potential partner proteins

    • Measurement of reaction rates with and without partner proteins

    • Analysis of intermediate accumulation under different conditions

Evidence from studies of carotenoid pathway enzymes suggests that substrate channeling may explain the preferred pathway for lutein synthesis: ring cyclizations to form α-carotene, followed by β-ring hydroxylation (by CYP97A3) to produce zeinoxanthin, and finally ε-ring hydroxylation (by CYP97C1) to produce lutein . Similar mechanisms might operate with BETA-OHASE 1 in the β,β-carotenoid branch of the pathway.

What are the structural determinants of BETA-OHASE 1 substrate specificity?

Understanding the structural basis of BETA-OHASE 1 substrate specificity requires:

  • Structural analysis approaches:

    • Homology modeling based on related hydroxylases with known structures

    • X-ray crystallography of purified BETA-OHASE 1 (with and without substrates)

    • Molecular docking simulations with different carotenoid substrates

  • Site-directed mutagenesis experiments:

    • Identify conserved residues in the substrate binding pocket

    • Create point mutations in potential key residues

    • Test mutant proteins for altered substrate preferences

  • Chimeric protein analysis:

    • Generate chimeric proteins between BETA-OHASE 1 and other hydroxylases (e.g., CYP97A3)

    • Map domains responsible for substrate recognition

The differential specificity of BETA-OHASE 1 for β-rings of β,β-carotenoids versus CYP97A3's preference for β-rings of α-carotene suggests specific structural adaptations that recognize the presence or absence of an ε-ring on the opposite end of the molecule . Identifying these structural features would advance understanding of carotenoid enzyme evolution.

What are the optimal conditions for expressing recombinant BETA-OHASE 1 in E. coli?

Optimizing recombinant BETA-OHASE 1 expression in E. coli requires careful consideration of several parameters:

  • Expression vector selection:

    • Vectors with strong, inducible promoters (e.g., T7, tac)

    • Addition of appropriate fusion tags (His, GST, MBP) to enhance solubility

    • Codon optimization for E. coli expression

  • Host strain selection:

    • BL21(DE3) or derivatives for T7-based expression

    • Strains with additional chaperones for improved folding

    • Rosetta strains for rare codon supplementation

  • Culture conditions optimization:

    • Induction at OD600 0.4-0.8

    • Lower temperatures (16-25°C) to enhance protein solubility

    • Extended expression times (16-24 hours) at reduced temperatures

    • IPTG concentration titration (0.1-1.0 mM)

  • Protein extraction considerations:

    • Inclusion of detergents for membrane-associated proteins

    • Use of mild lysis conditions to preserve enzymatic activity

    • Addition of protease inhibitors to prevent degradation

Based on successful expression of similar enzymes like GmBCH1 and GmBCH2, transformation of E. coli cells already producing β-carotene provides a functional assay system where BETA-OHASE 1 activity can be directly assessed through carotenoid analysis .

How can enzyme kinetics of BETA-OHASE 1 be accurately measured?

Measuring BETA-OHASE 1 enzyme kinetics presents unique challenges due to the hydrophobic nature of carotenoid substrates. A comprehensive approach includes:

  • Substrate preparation:

    • Purification of β-carotene from commercial sources

    • Solubilization in appropriate detergents or liposomes

    • Preparation of concentration series (typically 1-100 μM)

  • Reaction conditions:

    • Buffer composition: typically Tris-HCl (pH 7.5-8.0) with cofactors

    • Required cofactors: ferredoxin, ferredoxin-NADP+ reductase, NADPH

    • Temperature control (typically 25-30°C)

    • Time course analysis (sampling at 0, 5, 10, 15, 30, 60 min)

  • Product analysis methods:

    • HPLC separation with photodiode array detection

    • Quantification based on absorption at specific wavelengths

    • Standard curves with authentic standards

  • Data analysis:

    • Determination of initial velocities at different substrate concentrations

    • Lineweaver-Burk or Eadie-Hofstee plots

    • Non-linear regression to determine Km and Vmax values

ParameterTypical Range for Carotenoid HydroxylasesNotes
Km (β-carotene)5-20 μMMay vary with solubilization method
Vmax10-50 nmol/min/mgTemperature dependent
pH optimum7.5-8.5Buffer composition affects activity
Temperature optimum25-35°CHigher temperatures may reduce stability
NADPH requirement100-500 μMRegeneration system improves efficiency

What are the best approaches for generating and characterizing BETA-OHASE 1 knockout mutants?

Generating and characterizing BETA-OHASE 1 knockout mutants requires a systematic workflow:

  • Mutant generation strategies:

    • Identify existing T-DNA insertion lines from stock centers

    • Generate CRISPR/Cas9 knockouts targeting exon regions

    • RNAi constructs for knockdown if knockout is lethal

  • Genotype confirmation:

    • PCR-based genotyping to confirm T-DNA insertions or CRISPR edits

    • RT-PCR to verify transcript absence or reduction

    • Western blotting with specific antibodies to confirm protein absence

  • Phenotypic analysis:

    • HPLC analysis of carotenoid profiles in leaf tissue

    • Specific quantification of β-carotene and derived xanthophylls

    • Comparison with wild-type levels and statistical analysis

  • Physiological characterization:

    • Photosynthetic efficiency measurements

    • Light stress tolerance tests

    • Developmental phenotyping under various light conditions

Research with related hydroxylase mutants (such as b1b2, lut1-4, and lut5-1) has shown that while total carotenoid levels may not differ significantly from wild type, the carotenoid composition can be dramatically altered. For example, b1b2 mutants show lower levels of β,β-xanthophylls and increased β-carotene and lutein . Similar approaches would be valuable for characterizing BETA-OHASE 1 specific functions.

How conserved is BETA-OHASE 1 across plant species?

BETA-OHASE 1 belongs to the nonheme diiron monooxygenase family, which is widely distributed across carotenoid-producing organisms. Analysis of conservation requires:

  • Bioinformatic analysis:

    • Sequence alignment of BETA-OHASE 1 homologs from diverse plant species

    • Phylogenetic tree construction to determine evolutionary relationships

    • Identification of conserved domains and critical residues

  • Cross-species functional studies:

    • Expression of homologs from other species in Arabidopsis beta-ohase1 mutants

    • Complementation analysis to determine functional conservation

    • Heterologous expression in E. coli to compare enzymatic properties

Similar β-carotene hydroxylases have been characterized in multiple species, including soybean (Glycine max) where GmBCH1, GmBCH2, and GmBCH3 show enzymatic activities in converting β-carotene to zeaxanthin . In Adonis aestivalis, a β-carotene hydroxylase has been characterized and expressed in Arabidopsis . This functional conservation suggests BETA-OHASE 1 plays a fundamentally important role in plant carotenoid metabolism across diverse taxa.

What evidence exists for co-evolution between BETA-OHASE 1 and other carotenoid pathway enzymes?

Co-evolution analysis between BETA-OHASE 1 and other carotenoid biosynthetic enzymes requires:

  • Comparative genomic approaches:

    • Correlation of presence/absence patterns across species

    • Analysis of gene clustering in plant genomes

    • Investigation of shared regulatory elements

  • Molecular evolution studies:

    • Analysis of correlated substitution rates between pathway enzymes

    • Identification of complementary mutations that maintain protein interactions

    • Calculation of selection pressures on different pathway components

  • Experimental evidence:

    • Protein-protein interaction studies across species

    • Functional complementation with enzyme pairs from different species

The existence of distinct hydroxylase classes (nonheme diiron monooxygenases and cytochrome P450 monooxygenases) that can catalyze similar reactions represents an example of convergent evolution in carotenoid biosynthesis . This suggests that the selective pressure for carotenoid diversification has been strong throughout plant evolution, leading to the development of multiple enzyme systems with partially overlapping functions.

What are common issues in the purification of recombinant BETA-OHASE 1 and how can they be addressed?

Purification of recombinant BETA-OHASE 1 presents several challenges:

  • Protein solubility issues:

    • Challenge: BETA-OHASE 1 may form inclusion bodies in E. coli

    • Solution: Express at lower temperatures (16-20°C) with reduced inducer concentration

    • Alternative: Use solubility-enhancing fusion tags (MBP, SUMO, TRX)

    • Last resort: Purification under denaturing conditions followed by refolding

  • Maintaining enzymatic activity:

    • Challenge: Loss of activity during purification

    • Solution: Include stabilizing agents (glycerol 10-20%, reducing agents)

    • Consideration: Minimize freeze-thaw cycles and maintain cold chain

    • Approach: Perform activity assays at each purification step to track activity

  • Co-factor requirements:

    • Challenge: Loss of iron cofactors during purification

    • Solution: Supplement buffers with Fe²⁺ or Fe³⁺ salts

    • Consideration: Include appropriate reductants to maintain iron redox state

  • Membrane association:

    • Challenge: Partial membrane association complicating purification

    • Solution: Use mild detergents (0.1-1% Triton X-100 or n-dodecyl-β-D-maltoside)

    • Alternative: Consider nanodisc technology for membrane protein stabilization

Purification StepBuffer CompositionCritical Considerations
Cell lysis50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM DTTInclude protease inhibitors
Affinity chromatographyAbove + 10-250 mM imidazole gradientMinimize imidazole exposure time
Size exclusion25 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% glycerol, 1 mM DTTAnalyze oligomeric state
StorageAbove + additional 10% glycerolStore in small aliquots at -80°C

How can contradictory results in BETA-OHASE 1 functional studies be reconciled?

Contradictory results in functional studies of BETA-OHASE 1 may arise from several sources. Here's a methodological approach to reconciliation:

  • Experimental system differences:

    • Compare in vitro versus in vivo systems

    • Evaluate heterologous expression systems (E. coli, yeast, plant cells)

    • Consider the impact of subcellular localization on observed function

  • Substrate availability and presentation:

    • Analyze substrate solubilization methods

    • Consider membrane environment effects on enzyme activity

    • Evaluate potential substrate channeling effects in different systems

  • Genetic background effects:

    • Compare results across different ecotypes/accessions

    • Consider the impact of redundant hydroxylases in different backgrounds

    • Evaluate epistatic interactions with other pathway components

  • Standardized methods development:

    • Establish reference protocols for activity assays

    • Create standard operating procedures for carotenoid extraction and analysis

    • Develop validated calibration standards for quantification

When interpreting apparently contradictory results, it's important to consider the partial functional redundancy observed between carotenoid hydroxylases. For example, CYP97A3 (LUT5) mutants still produce 80% of wild-type lutein levels, indicating other hydroxylases can partially compensate for its loss . Similarly, the activities of nonheme (BETA-OHASE 1 and 2) and P450 (CYP97A3) β-ring hydroxylases show partial overlap but with different substrate preferences.

How can BETA-OHASE 1 be used in metabolic engineering of carotenoid biosynthesis?

BETA-OHASE 1 can be strategically employed in metabolic engineering applications:

  • Enhancing xanthophyll production in crops:

    • Overexpression of BETA-OHASE 1 to increase zeaxanthin and downstream xanthophylls

    • Balancing expression with other pathway enzymes to prevent bottlenecks

    • Tissue-specific expression to target accumulation in edible tissues

  • Stress tolerance improvement:

    • Enhanced expression to increase photoprotective xanthophylls

    • Co-expression with zeaxanthin epoxidase to enhance xanthophyll cycle activity

    • Development of stress-inducible expression systems

  • Nutritional enhancement strategies:

    • Targeted enhancement of provitamin A carotenoids in food crops

    • Fine-tuning hydroxylase activities to optimize specific carotenoid profiles

    • Development of golden rice-type biofortification approaches

Overexpression of BCH has been found to confer tolerance to light stress, highlighting a practical application for BETA-OHASE 1 in crop improvement . Similar approaches have been successfully used in carotenoid biofortification efforts, such as Golden Rice development, where engineering of the carotenoid biosynthetic pathway resulted in enhanced β-carotene content .

What new technologies could advance research on BETA-OHASE 1 function?

Emerging technologies that could significantly advance BETA-OHASE 1 research include:

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize subcellular localization

    • FRET/FLIM to detect protein-protein interactions in vivo

    • Label-free Raman microscopy for carotenoid visualization in living cells

  • Protein structure determination approaches:

    • Cryo-electron microscopy for membrane-associated protein complexes

    • Integrative structural biology combining multiple experimental data types

    • AlphaFold2 and other AI-based structure prediction tools

  • Genome editing technologies:

    • CRISPR base editing for precise amino acid substitutions

    • Prime editing for specific sequence replacements

    • Multiplexed CRISPR for simultaneous modification of pathway components

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Flux analysis of carotenoid biosynthetic pathways

    • Mathematical modeling of pathway dynamics

TechnologyApplication to BETA-OHASE 1 ResearchExpected Outcomes
Cryo-EMStructure determination of BETA-OHASE 1 in membrane contextInsights into substrate binding and catalytic mechanism
Multiplexed CRISPRGeneration of combinatorial hydroxylase mutantsComprehensive functional redundancy map
Metabolic flux analysisQuantification of flux through different hydroxylation routesIdentification of rate-limiting steps
Synthetic biologyReconstitution of minimal carotenoid hydroxylation systemsEngineering optimized pathways for biotechnology

These advanced technologies would complement the established biochemical and molecular approaches, providing deeper insights into the structure-function relationships and metabolic context of BETA-OHASE 1 activity.

What are the most critical unresolved questions about BETA-OHASE 1?

Despite significant progress in understanding carotenoid hydroxylases, several critical questions about BETA-OHASE 1 remain unresolved:

  • Structural mechanisms:

    • What are the precise structural determinants of substrate specificity?

    • How does BETA-OHASE 1 coordinate with membrane architecture?

    • What is the molecular basis for the differential activity on various β-ring containing carotenoids?

  • Regulatory mechanisms:

    • How is BETA-OHASE 1 expression and activity regulated in response to environmental stimuli?

    • What post-translational modifications affect BETA-OHASE 1 function?

    • How is the balance between redundant hydroxylases maintained?

  • Metabolic integration:

    • How does BETA-OHASE 1 activity influence flux through the entire carotenoid pathway?

    • What metabolic feedback mechanisms regulate hydroxylase activity?

    • How do protein-protein interactions influence BETA-OHASE 1 function in vivo?

Addressing these questions will require integrative approaches combining structural biology, advanced genetic tools, and systems-level analysis. The partial redundancy between different carotenoid hydroxylases makes isolating BETA-OHASE 1-specific functions particularly challenging, necessitating careful experimental design and interpretation.

What is a recommended experimental workflow for new researchers working with BETA-OHASE 1?

For researchers new to BETA-OHASE 1, the following systematic workflow is recommended:

  • Initial characterization:

    • Confirm expression patterns using qRT-PCR and promoter-reporter fusions

    • Verify subcellular localization using fluorescent protein fusions

    • Analyze basic enzyme properties using heterologous expression in E. coli

  • Genetic analysis:

    • Obtain or generate knockout mutants

    • Perform detailed phenotypic analysis focusing on carotenoid profiles

    • Create complementation lines to confirm phenotype specificity

    • Develop higher-order mutants with other hydroxylases to assess redundancy

  • Biochemical studies:

    • Express and purify recombinant protein

    • Characterize enzymatic properties (substrate specificity, kinetics)

    • Identify interaction partners through co-immunoprecipitation or yeast two-hybrid

  • Integration and application:

    • Develop metabolic engineering strategies based on findings

    • Test hypotheses about physiological roles through stress treatments

    • Apply knowledge to crop improvement through transgenic approaches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.