Recombinant Arabidopsis thaliana BI1-like protein (At4g15470)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Plant Biology

At4g15470 is primarily associated with modulating plant stress responses:

Suppression of Programmed Cell Death (PCD)

  • Mechanism: Localizes to the endoplasmic reticulum (ER) and inhibits PCD triggered by pathogens or environmental stress .

  • Pathogen Interaction: Overexpression or knockdown of AtLFG1/AtLFG2 (homologs) alters susceptibility to powdery mildew (Erysiphe cruciferarum) by regulating cell death around fungal haustoria .

Metabolic and Stress Adaptation

  • ER Stress: Protects against ER stress-induced apoptosis, a conserved function across eukaryotes .

  • Abiotic Stress: May interact with SnRK1 (Sucrose Non-Fermenting-1 Related Protein Kinase 1) to integrate metabolic signals, though direct evidence for At4g15470 remains limited .

Research Applications and Experimental Tools

The recombinant At4g15470 is used in:

ApplicationDescriptionSource
ELISA/Western BlottingServes as an antigen to detect endogenous BI1-like proteins in Arabidopsis.
Protein Interaction StudiesIdentifies binding partners (e.g., ABAP1, KIN10) using co-IP or Y2H assays.
Pathogen Interaction ModelsStudies PCD suppression during fungal colonization in Arabidopsis mutants.

Role in Disease Susceptibility

  • Powdery Mildew: Silencing AtLFG1/AtLFG2 delays fungal colonization by restricting haustorial formation, while overexpression enhances susceptibility .

  • ER Stress: Suppresses PCD during ER stress, analogous to mammalian BI-1 proteins .

Interaction Networks

  • ABAP1/KIN10: AIP10 (a distinct protein) interacts with ABAP1 and SnRK1 to regulate cell cycle and metabolism, though At4g15470’s direct role in these pathways remains unexplored .

  • Protein Kinases: Potential phosphorylation sites align with SnRK1/KIN10 consensus motifs (e.g., MLVFI X RKH XX S/T XXX LFIMV) .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if necessary. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and storing in aliquots at -20°C or -80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C or -80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
LFG5; At4g15470; dl3775w; FCAALL.58; BI1-like protein; Protein LIFEGUARD 5; AtLFG5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-256
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
LFG5
Target Protein Sequence
MDKPYGYASVSMSGIDRSAGKDIDLEMGVGEATLYPGLSYGENQLRWGFIRKVYGILSAQ LLLTTLISAVVVLNPPVNDLLTGSPGILLFLCIVPFILIWPLHIYHQKHPVNLILLALFT VSLSFTVGVSCAMTEGRIVLQALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLII LVVTSFIQMFFPLGPTSVAVYGGFSALVFCGYIVYDTDNLIKRFTYDEYILASVALYLDI LNLFLTILRILRQGDN
Uniprot No.

Target Background

Database Links

KEGG: ath:AT4G15470

STRING: 3702.AT4G15470.1

UniGene: At.20495

Protein Families
BI1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What cellular functions does At4g15470 perform?

At4g15470 functions as a cell death regulator with anti-apoptotic properties. Research has demonstrated that AtGAAPs, including LFG5, can inhibit Bax-induced cell death when expressed in yeast . The protein is involved in regulating ionic homeostasis within the cell through its function as an ion channel .

Phylogenetic analysis indicates that while Lfg and BI-1 proteins form separate protein families, at least one member of the Lfg-family shows similar protective effects against campthothecin-induced apoptosis as BI-1 . This suggests functional conservation in cell death regulation mechanisms despite structural differences between these protein families.

Where is At4g15470 protein localized in plant cells?

The subcellular localization of At4g15470 has been determined through fluorescent protein fusion studies. While some GAAP family members like AtGAAP1 and AtGAAP4 localize exclusively to the Golgi complex, AtGAAP5 (which corresponds to At4g15470/LFG5) shows localization to both the Golgi complex and the tonoplast (vacuolar membrane) . This dual localization pattern may be important for its function in regulating cell death by affecting ionic homeostasis in different cellular compartments.

In contrast, the related protein BI-1 is localized to the endoplasmic reticulum (ER) in Hydra and other organisms, showing distinct localization patterns among different members of cell death regulator families .

How is At4g15470 structurally characterized?

At4g15470 encodes a membrane protein with 7 α-helix transmembrane domains. Structural modeling of AtGAAPs predicts the presence of a channel-like pore with conserved aspartate residues positioned toward the center . These models suggest that:

  • In the closed state, interactions between aspartate residues block the transmembrane pore

  • In the open state, these residues are spaced further apart

  • Surface models show a continuous pore that fully traverses the membrane in the open state

These structural characteristics support the function of At4g15470 as an ion channel . The protein shows similarity to BsYetJ, with conserved aspartate residues corresponding to D171 and D195 of BsYetJ, which are critical for channel function .

What experimental approaches are most effective for studying At4g15470 function?

Several complementary approaches have proven effective for studying At4g15470 function:

ApproachMethodologyApplication
Recombinant protein expressionExpression in E. coli, yeast, baculovirus or mammalian cell systemsStructural and functional studies
Protein purificationNi²⁺-NTA affinity chromatography, size exclusion chromatographyObtaining pure protein for biochemical assays
ElectrophysiologyReconstitution into lipid bilayersIon channel activity characterization
Fluorescent protein fusionN/C-terminal YFP/GFP taggingSubcellular localization studies
Yeast complementationExpression in S. cerevisiae with BaxCell death inhibition assays
T-DNA insertion linesSALK lines with insertions in exonsLoss-of-function studies
Transient expressionAgrobacterium-mediated infiltration in N. benthamianaOverexpression studies
qRT-PCRRNA isolation followed by reverse transcription and PCRExpression analysis

Research has shown that purified AtGAAP3 (a related protein) can be successfully reconstituted into lipid bilayers for electrophysiological recording to demonstrate ion channel function . This approach could be applied to At4g15470 as well.

How does At4g15470 regulate programmed cell death in plants?

At4g15470 regulates programmed cell death (PCD) in plants as part of the GAAP family. The mechanistic basis for this regulation involves:

  • Functioning as an ion channel that affects cellular ionic homeostasis, particularly calcium fluxes

  • Inhibiting Bax-induced cell death pathways when expressed heterologously in yeast

  • Potentially interacting with other cell death regulatory proteins

The GAAP family shows expansion in Arabidopsis with five paralogues (AtGAAP1-5), suggesting potential functional specialization . Interestingly, while AtGAAP1-5 all inhibit Bax-induced cell death in yeast, overexpression of AtGAAP1 induces cell death in Nicotiana benthamiana leaves and causes lesion mimic phenotypes in Arabidopsis . This suggests complex regulatory mechanisms that depend on expression levels and cellular context.

What is the evolutionary conservation of At4g15470 across plant species?

At4g15470 belongs to the GAAP family, which shows remarkable evolutionary conservation across eukaryotes. Key evolutionary features include:

  • The GAAP gene family shows expansion in plants, with five paralogues in Arabidopsis (AtGAAP1-5)

  • Phylogenetic analysis indicates that Lfg and BI-1 proteins form separate protein families, though both regulate cell death

  • Similar proteins have been identified in organisms ranging from Hydra to humans, indicating early evolutionary origin

  • Functional conservation is maintained despite sequence divergence, with plant GAAPs able to inhibit Bax-induced cell death similar to their mammalian and viral counterparts

This conservation suggests that these proteins play fundamental roles in cellular processes that have been maintained throughout evolution due to their critical functions in regulating cell death.

How does experimental design affect research outcomes when studying At4g15470?

When designing experiments to study At4g15470, several critical factors influence research outcomes:

  • Selection of appropriate expression systems: Different expression systems (E. coli, yeast, baculovirus, mammalian cells) yield varying protein quantities and quality . For membrane proteins like At4g15470, eukaryotic systems often provide better folding.

  • Block design for plant studies: Implementing block designs where plants are grouped according to specific variables (e.g., genotype, age) helps control experimental variability and increases statistical power . This is particularly important when studying subtle phenotypes.

  • Statistical considerations: The Arabidopsis fruit length example demonstrates how proper statistical design enables detection of significant differences between transgenic lines and controls . Using randomized block designs can reduce variability and increase statistical power.

  • Control selection: Proper controls are essential - experimental design should include wild-type controls, empty vector controls, and potentially multiple independent transgenic lines to account for position effects of transgene insertion .

  • Matched pairs design: For studying treatment effects (e.g., drought stress responses), matched pairs experimental design can help control for lurking variables .

What is the role of At4g15470 in plant stress responses?

While direct evidence for At4g15470's specific role in stress responses is limited in the provided search results, related research suggests potential functions:

  • The study by Motamedi showed that one member of the Lfg-family in Hydra exhibited up-regulation when treated with Benzo[a]pyrene, indicating responsiveness to chemical stress .

  • Research on Arabidopsis identified WRKY38 and LSD1 genes showing significant genotype-by-environment interactions under drought stress, demonstrating how some genes contribute to environmental adaptation . Similar experimental approaches could reveal At4g15470's role in stress responses.

  • As a cell death regulator, At4g15470 likely functions in stress-induced programmed cell death pathways that are activated during drought, pathogen attack, or other environmental stresses.

  • The localization of At4g15470 to both the Golgi and tonoplast suggests it may play roles in stress signaling pathways that involve these organelles .

How can recombinant At4g15470 be expressed and purified for functional studies?

Effective expression and purification of recombinant At4g15470 requires specialized approaches for membrane proteins:

Expression systems:

  • E. coli expression system with appropriate vectors (typically with N-terminal tags)

  • Yeast expression systems (beneficial for membrane proteins)

  • Baculovirus expression system (for complex proteins)

  • Mammalian cell expression (for proteins requiring specific post-translational modifications)

Purification protocol:

  • Extract protein using detergents that maintain protein stability and function

  • Purify using Ni²⁺-NTA affinity chromatography for His-tagged proteins

  • Further purify by size exclusion chromatography to separate oligomeric states

  • Store in appropriate buffer (e.g., Tris-based buffer with 50% glycerol)

Storage conditions:

  • Store at -20°C for short-term storage

  • Use -80°C for extended storage

  • Avoid repeated freeze-thaw cycles

Tag removal (if needed):

  • Include TEV protease cleavage site between tag and protein

  • Treat purified protein with TEV protease (functional at both 10°C and 25°C)

How does At4g15470 function as an ion channel?

Structural and functional evidence supports At4g15470's role as an ion channel:

  • Structural features: Homology modeling predicts a pore-like structure with conserved aspartate residues that can interact to block or open a transmembrane channel .

  • Oligomerization states: Related GAAPs form multiple oligomeric states (monomers, dimers, and higher-order oligomers) as demonstrated by size exclusion chromatography and non-reducing SDS-PAGE .

  • Direct evidence: Electrophysiological recordings of purified AtGAAP3 reconstituted into lipid bilayers confirmed channel activity, providing strong evidence that plant GAAPs function as ion channels .

  • Biophysical properties: The channel likely has cation selectivity, similar to viral GAAPs which form cation-selective channels .

  • Regulatory mechanism: The channel appears to function through a conformational change mechanism where salt bridges between conserved aspartate residues and basic residues stabilize the closed state, while disruption of these salt bridges opens the pore by displacing transmembrane domains .

How can contradictory data about At4g15470 function be reconciled?

When facing contradictory results about At4g15470 function, consider these reconciliation approaches:

  • Genetic background effects: Different Arabidopsis ecotypes may show varying phenotypes. The study of genome-environment associations found significant variation in gene function across different natural accessions .

  • Technical variations: Different expression systems, purification methods, or assay conditions can yield contradictory results. For example, the GB1 domain was shown to increase expression levels of recombinant proteins in plants by 1.3 to 3.1-fold depending on the target protein , illustrating how technical choices affect outcomes.

  • Functional redundancy: The expansion of the GAAP family in Arabidopsis (five paralogues) suggests potential functional redundancy. Single gene knockouts may show no phenotype while multiple gene knockouts might reveal functions .

  • Experimental conditions: Environmental factors significantly impact gene function. As demonstrated in drought experiments, genotype-by-environment interactions can reveal functions not apparent under standard growth conditions .

  • Data resolution and quality: Using advanced approaches like experiment-time data analysis pipelines that leverage high-performance computing can provide higher resolution data and more reliable results .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.