Recombinant Arabidopsis thaliana Bidirectional sugar transporter SWEET10 (SWEET10)

Shipped with Ice Packs
In Stock

Description

Overview of SWEET10

Recombinant Arabidopsis thaliana SWEET10 is a bidirectional sucrose transporter belonging to the SWEET (Sugars Will Eventually be Exported Transporters) family. It facilitates the movement of sugars across cellular membranes and plays critical roles in plant development, including floral transition and pathogen responses . The recombinant form is produced in heterologous systems (E. coli, yeast, baculovirus, or mammalian cells) with ≥85% purity confirmed by SDS-PAGE .

Floral Transition

  • Photoperiod-dependent activation: SWEET10 is transcriptionally induced by FLOWERING LOCUS T (FT) and SUPPRESSOR OF CONSTANS OVEREXPRESSION 1 (SOC1) under long-day conditions .

  • Mechanism: Enhances sucrose efflux from leaf veins to the shoot apical meristem, accelerating flowering .

  • Phenotypic impact: Overexpression causes early flowering and upregulates floral integrators like LEAFY .

Pathogen Resistance

  • Sugar modulation: SWEET10 overexpression reduces leaf sucrose content, limiting nutrient availability to pathogens like Fusarium oxysporum .

  • Transgenic application: SWEET10-engineered plants exhibit enhanced resistance to fungal infections .

Substrate Specificity and Transport Mechanism

SWEET10 primarily transports sucrose but exhibits bidirectional activity (inward/outflow) . Key findings include:

SubstrateTransport EfficiencyKey ResiduesReferences
SucroseHigh affinityTrp58, Asn76, Ser176
GlucoseLow affinityLeu23, Met145
  • Oligomerization requirement: Functional transport requires dimerization/oligomerization of SWEET10 units .

  • pH sensitivity: Optimal activity at pH 6.5–7.0 .

Agricultural Engineering

  • Yield improvement: SWEET10 overexpression in crops like sweet potato enhances sucrose allocation to storage roots .

  • Disease resistance: Transgenic lines with modified SWEET10 expression show reduced susceptibility to pathogens .

Comparative Analysis With Other SWEET Transporters

FeatureSWEET10SWEET8SWEET1
Substrate preferenceSucrose > GlucoseGlucoseGlucose
Tissue expressionLeaf veins, shoot apexPollen, tapetumPhloem parenchyma
Role in developmentFloral transitionPollen viabilityPhloem loading
Pathogen interactionReduces sugar availabilityNeutralSusceptibility factor
References

Future Research Directions

  1. Mechanistic studies: Elucidate how SWEET10 interacts with FT/SOC1 at the molecular level.

  2. Crop engineering: Optimize SWEET10 expression to balance sugar allocation and stress tolerance .

  3. Structural dynamics: Resolve conformational changes during sucrose transport using cryo-EM .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
SWEET10; At5g50790; MFB16.19; Bidirectional sugar transporter SWEET10; AtSWEET10; Protein SUGARS WILL EVENTUALLY BE EXPORTED TRANSPORTERS 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SWEET10
Target Protein Sequence
MAISQAVLATVFGILGNIISFFVCLAPIPTFVRIYKRKSSEGYQSIPYVISLFSAMLWMY YAMIKKDAMMLITINSFAFVVQIVYISLFFFYAPKKEKTLTVKFVLFVDVLGFGAIFVLT YFIIHANKRVQVLGYICMVFALSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWF FYGLLLKDMNIALPNVLGFIFGVLQMILFLIYKKPGTKVLEPPGIKLQDISEHVVDVVRL STMVCNSQMRTLVPQDSADMEATIDIDEKIKGDIEKNKDEKEVFLISKN
Uniprot No.

Target Background

Function
This protein mediates both low-affinity uptake and efflux of sugar across the plasma membrane.
Database Links

KEGG: ath:AT5G50790

STRING: 3702.AT5G50790.1

UniGene: At.7905

Protein Families
SWEET sugar transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does AtSWEET10 differ from other members of the SWEET transporter family?

AtSWEET10 belongs to Clade III of the SWEET family, which primarily includes sucrose transporters, distinguishing it from Clade I and II members that predominantly transport monosaccharides . When designing experiments to characterize functional differences, consider:

FeatureAtSWEET10Other SWEETs (e.g., AtSWEET1, AtSWEET9)
Primary substrateSucroseGlucose (AtSWEET1), Sucrose (AtSWEET9)
Expression patternFloral transitionRoot (AtSWEET1), Nectaries (AtSWEET9)
Regulatory pathwayFLOWERING LOCUS TVarious pathways
Physiological roleFlowering time regulationVarious roles including nectar secretion

For experimental validation of these differences, comparative electrophysiology using heterologous expression systems is recommended, alongside substrate specificity assays. Complementary approaches include expression profiling across tissues and developmental stages to map the distinct spatiotemporal patterns of different SWEET transporters.

What expression systems are optimal for producing functional recombinant AtSWEET10?

While E. coli is commonly used for AtSWEET10 expression, several systems offer advantages depending on your research objectives :

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, low cost, rapid productionLimited post-translational modificationsStructural studies, antibody production
Yeast (S. cerevisiae)Eukaryotic processing, moderate yieldSome glycosylation differencesTransport assays, protein-protein interactions
Insect cellsCloser to plant post-translational modificationsHigher cost, longer production timeFunctional studies requiring authentic modifications
Plant cell cultureNative-like modificationsLower yield, technically challengingStudies requiring authentic plant processing

For optimal functional expression, the inclusion of appropriate protease inhibitors during purification is critical. Additionally, membrane protein solubilization requires careful selection of detergents—typically DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol) work well for SWEET transporters while maintaining their functional integrity.

How can sugar transport activity of AtSWEET10 be accurately measured in experimental settings?

Several complementary approaches enable robust measurement of AtSWEET10 bidirectional transport activity:

  • FRET-based sensors: Co-express AtSWEET10 with the high-sensitivity FRET glucose sensor FLIPglu600mD13V in cells with low endogenous glucose uptake (e.g., HEK293T) . This allows real-time monitoring of sugar flux.

  • Radiolabeled substrate assays: Use 14C-labeled sucrose for quantitative uptake and efflux measurements in various expression systems.

  • Electrophysiological methods: Two-electrode voltage clamp in Xenopus oocytes can directly measure transport-associated currents.

  • Reconstituted proteoliposomes: For in vitro studies of purified protein, incorporate AtSWEET10 into liposomes and measure bidirectional transport under controlled conditions.

To specifically assess bidirectional capacity, express the FRET glucose sensor FLIPglu600mD13VER in the endoplasmic reticulum lumen and monitor internal sugar concentrations . This approach has been successfully used for other SWEET transporters and provides valuable insights into the mechanistic aspects of bidirectional transport.

How does AtSWEET10 contribute to flowering time regulation?

AtSWEET10 plays a critical role in the photoperiod-dependent flowering pathway through its activation by the FLOWERING LOCUS T (FT) signaling mechanism . Experimental evidence demonstrates that:

  • AtSWEET10 is transcriptionally activated by the FT-signaling pathway specifically during floral transition.

  • Overexpression of AtSWEET10 results in early flowering phenotypes, suggesting it functions downstream of FT in the flowering regulatory network .

  • The likely mechanism involves FT-mediated upregulation of AtSWEET10 to facilitate increased sugar transport to the shoot apical meristem during floral transition.

To investigate this relationship experimentally, researchers should:

  • Perform ChIP-seq to identify potential FT-dependent transcription factor binding sites in the AtSWEET10 promoter

  • Analyze AtSWEET10 expression in ft mutant backgrounds under different photoperiodic conditions

  • Conduct sugar transport measurements at the shoot apex during floral transition in wild-type vs. sweet10 mutant plants

  • Complement sweet10 mutants with tissue-specific expression to determine where AtSWEET10 function is required

What phenotypic effects are observed in AtSWEET10 knockout and overexpression lines?

Genetic manipulation of AtSWEET10 produces distinct phenotypes that inform its physiological functions:

Genetic ModificationObserved PhenotypesExperimental Approach
Knockout/knockdownDelayed flowering under inductive photoperiods, Altered sugar distributionT-DNA insertion lines, CRISPR-Cas9 knockouts
OverexpressionEarly flowering, Enhanced sugar mobilization during floral transition35S promoter or tissue-specific overexpression
Tissue-specific complementationRestoration of wild-type flowering when expressed in phloem or meristemCell-type specific promoters driving AtSWEET10

For robust phenotypic analysis, researchers should measure flowering time under both long-day and short-day conditions, quantify sugar content in relevant tissues (leaves, shoot apex), and examine transcript levels of flowering time genes to position AtSWEET10 in the flowering regulatory network.

How can CRISPR-Cas9 genome editing be optimized for AtSWEET10 functional studies?

CRISPR-Cas9 technology offers powerful approaches for AtSWEET10 characterization:

  • Guide RNA design strategy:

    • Target conserved regions within transmembrane domains for knockout studies

    • Design multiple sgRNAs (minimum 3) targeting different exons to ensure complete knockout

    • Use tools like CRISPOR or CHOPCHOP for off-target prediction and efficiency scoring

  • Recommended editing approaches:

    • For complete gene knockout: target early exons to induce frameshift mutations

    • For specific domain analysis: use homology-directed repair with donor templates

    • For promoter studies: target regulatory regions identified through chromatin accessibility analysis

  • Validation protocol:

    • PCR-based genotyping followed by Sanger sequencing of the target region

    • RT-qPCR to confirm transcript reduction/elimination

    • Western blotting with anti-SWEET10 antibodies to verify protein absence

    • Complementation with wild-type AtSWEET10 to confirm phenotype causality

This approach enables precise dissection of structure-function relationships and can be combined with fluorescent protein tagging for in vivo localization studies.

What methods can identify post-translational modifications of AtSWEET10 and their functional significance?

Post-translational modifications (PTMs) can significantly affect AtSWEET10 activity and localization. A comprehensive experimental workflow should include:

  • Identification phase:

    • Mass spectrometry-based phosphoproteomics of membrane fractions

    • Site-specific antibodies against common PTMs (phosphorylation, ubiquitination)

    • In vitro kinase assays to identify regulatory kinases

  • Functional analysis:

    • Generate site-directed mutants at identified PTM sites:

      • Phosphomimetic mutations (S/T→D/E)

      • Phosphodeficient mutations (S/T→A)

    • Assess these variants for:

      • Transport activity using FRET-based sensors

      • Subcellular localization using fluorescent protein fusions

      • Protein stability through cycloheximide chase assays

  • Physiological relevance:

    • Express PTM-site mutants in sweet10 backgrounds

    • Evaluate flowering time and sugar distribution

    • Analyze responses to environmental signals known to affect flowering

This systematic approach connects molecular modifications to physiological outcomes, providing mechanistic insights into AtSWEET10 regulation.

How has the function of SWEET10 evolved across different plant species?

Comparative genomics approaches reveal evolutionary patterns in SWEET10 function:

  • Phylogenetic analysis shows that SWEET10 orthologs are conserved across flowering plants, suggesting fundamental roles in plant development.

  • Experimental comparison between Arabidopsis AtSWEET10 and orthologs from other species reveals:

    • Conserved roles in reproductive development across flowering plants

    • Species-specific adaptations related to flowering strategies

    • Variation in regulatory elements controlling expression patterns

To experimentally investigate functional conservation, researchers should:

  • Clone SWEET10 orthologs from diverse plant species

  • Test functional complementation in Arabidopsis sweet10 mutants

  • Compare promoter activities using reporter gene assays

  • Examine expression patterns in relation to reproductive development across species

This evolutionary perspective provides insights into the core functions of SWEET10 and its adaptive significance across plant lineages.

How do plant pathogens interact with and potentially exploit AtSWEET10?

While several SWEET transporters are known pathogen targets, AtSWEET10's specific role in plant-pathogen interactions requires further investigation:

  • Expression analysis during infection:

    • Monitor AtSWEET10 transcriptional changes upon challenge with bacterial, fungal, and viral pathogens

    • Compare with well-known pathogen-targeted SWEETs like AtSWEET13 and AtSWEET14

  • Functional assessment:

    • Challenge sweet10 mutants with diverse pathogens and assess disease progression

    • Measure apoplastic sugar levels during infection in wild-type vs. mutant plants

    • Test if pathogen effectors directly target AtSWEET10 promoter elements using yeast one-hybrid assays

  • Comparative analysis with other SWEETs:

    • Several SWEET transporters are induced during pathogen invasion

    • Determine if AtSWEET10 shows similar induction patterns or has evolved resistance to pathogen manipulation

This research direction connects sugar transport with plant immunity, potentially revealing novel disease resistance strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.