Recombinant Arabidopsis thaliana Bidirectional sugar transporter SWEET11 (SWEET11)

Shipped with Ice Packs
In Stock

Description

Functional Roles

SWEET11 facilitates sucrose efflux from cells, playing roles in:

  • Phloem Loading: Synergizes with SWEET12 to export sucrose from mesophyll cells to the apoplast, enabling subsequent uptake by SUT/SUC transporters .

  • Seed Filling: Regulates sucrose allocation during seed development .

  • Pathogen Interaction: Modulates sucrose levels at infection sites, influencing plant defense responses .

Table 1: Physiological Roles of SWEET11

ProcessMechanismImpact
Phloem LoadingSucrose efflux to apoplast Enables H⁺/sucrose cotransport by SUTs
Seed DevelopmentSucrose transport to developing seeds Ensures proper seed filling
Pathogen DefenseAlters sucrose availability at infection sites Triggers salicylic acid (SA)-mediated defense

Oligomerization and Transport Mechanism

SWEET11 forms homodimers or heterodimers (e.g., with SWEET12) to create functional pores. Mutational studies show that oligomerization is essential for activity:

  • Negative Dominance: Coexpression of inactive mutants (e.g., Y57/G58 mutations) inhibits wild-type SWEET1 function, confirming inter-subunit interactions .

  • Structural Basis: Molecular docking reveals conserved sucrose-binding pockets in SWEET11 and SWEET12, with residues (e.g., Thr, Ser) stabilizing sucrose via hydrogen bonds .

Pathogen Interaction Insights

  • sweet11/sweet12 Double Mutants: Show elevated sucrose, hexose, and starch levels, leading to enhanced resistance to Colletotrichum higginsianum via SA priming .

  • Local Induction: SWEET12 (but not SWEET11) accumulates at infection sites, though its role in fungal nutrition remains unclear .

Applications of Recombinant SWEET11

Recombinant SWEET11 is widely used in:

  • Functional Assays: Sucrose transport studies in heterologous systems (e.g., Xenopus oocytes, HEK293T cells) .

  • Structural Biology: Crystallization and cryo-EM studies to resolve transporter conformational changes .

  • Crop Improvement: Homologs like OsSWEET11 in rice are studied for enhancing sucrose transport efficiency .

Table 2: Experimental Uses of Recombinant SWEET11

ApplicationMethodologyOutcome
Sucrose Transport Assays[¹⁴C] Sucrose uptake in Xenopus oocytes Quantification of efflux rates
Oligomerization StudiesSplit-ubiquitin yeast two-hybrid assays Demonstration of dimer formation
Pathogen-Plant InteractionCh infection assays in sweet11/sweet12 double mutants Linking sucrose metabolism to SA signaling

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
The shelf life of our products depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
SWEET11; At3g48740; T21J18.1; T8P19.250; Bidirectional sugar transporter SWEET11; AtSWEET11; Protein SUGARS WILL EVENTUALLY BE EXPORTED TRANSPORTERS 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SWEET11
Target Protein Sequence
MSLFNTENTWAFVFGLLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSIPYVVALFSATLW LYYATQKKDVFLLVTINAFGCFIETIYISMFLAYAPKPARMLTVKMLLLMNFGGFCAILL LCQFLVKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVI WLLYGLALKDIYVAFPNVLGFALGALQMILYVVYKYCKTSPHLGEKEVEAAKLPEVSLDM LKLGTVSSPEPISVVRQANKCTCGNDRRAEIEDGQTPKHGKQSSSAAAT
Uniprot No.

Target Background

Function
SWEET11 is a bidirectional sugar transporter that mediates both low-affinity uptake and efflux of sugar across the plasma membrane. It plays a crucial role in phloem loading by facilitating sugar export from parenchyma cells and supporting H(+)-coupled import into the sieve element/companion cell complex, thus contributing to the movement of sucrose from synthesis sites in the mesophyll to the phloem. Additionally, SWEET11 contributes to seed filling by triggering sucrose efflux, which is essential for the transfer of sugars from the seed coat to the embryos.
Gene References Into Functions
  1. Data indicates that the transcript levels of sucrose transporters AtSUC2, AtSWEET11, AtSWEET12, and AtSWEET15 are significantly higher in stressed roots. PMID: 26802041
  2. In addition to their role in phloem loading in source leaves, the AtSWEET11 and AtSWEET12 proteins act as sugar exporters that deliver carbon-containing skeletons to developing xylem cells to support secondary cell wall formation. PMID: 26358680
  3. SWEET11, 12, and 15 exhibit specific spatiotemporal expression patterns in developing seeds. PMID: 25794936
  4. A subfamily of SWEET sucrose efflux transporters, AtSWEET11 and 12, localize to the plasma membrane of the phloem. Mutant plants with insertions in AtSWEET11 and 12 show defects in phloem loading, revealing a two-step mechanism of SWEET-mediated export. PMID: 22157085
Database Links

KEGG: ath:AT3G48740

STRING: 3702.AT3G48740.1

UniGene: At.27455

Protein Families
SWEET sugar transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in leaves, especially in phloem. Expressed in developing seeds.

Q&A

What is SWEET11 and what is its primary function in Arabidopsis thaliana?

SWEET11 (At3g48740) is a member of the SWEET (Sugars Will Eventually be Exported Transporters) family that functions as a bidirectional sugar transporter in Arabidopsis thaliana . It facilitates the diffusion of sugars, primarily sucrose, across cell membranes along concentration gradients . SWEET11 is a low-affinity sucrose transporter that exhibits a uniporter transport mechanism as its transport activity is pH independent .

The primary functions of SWEET11 include:

  • Phloem loading for long-distance sugar transport

  • Seed filling during embryo development

  • Contributing to sugar level alterations during pathogen infection

SWEET11 operates as a plasma membrane-localized efflux carrier that provides the prerequisite for H+/sucrose cotransporters like SUT1/SUC2 to transport sucrose from the apoplast to the sieve-element-companion-cell complex, thus completing the process of phloem apoplastic loading .

What is the expression pattern of SWEET11 during plant development?

SWEET11 exhibits specific spatiotemporal expression patterns during plant development:

  • In seeds: SWEET11 transcripts accumulate primarily in the endosperm and seed coat during the linear cotyledon stage and the maturation green stage .

  • In vegetative tissues: SWEET11 is expressed in leaves, roots, siliques, and flowers .

  • Cell-specific expression: SWEET11 is specifically localized to the plasma membrane of phloem parenchyma (PP) cells in leaves .

Confocal microscopy of Arabidopsis seeds from plants expressing native promoter-driven translational SWEET11-eGFP fusions shows strong fluorescence in the endosperm at the linear cotyledon stage, with weaker fluorescence detected in the chalazal seed coat . Transmission electron microscopy (TEM) immunocytochemistry further supports the plasma membrane localization of SWEET11 .

How can researchers effectively visualize SWEET11 expression and localization in plant tissues?

Researchers can employ several complementary approaches to visualize SWEET11 expression and localization:

  • Promoter-reporter fusion constructs: Using native SWEET11 promoter-driven GUS (β-glucuronidase) constructs for histochemical analysis and cross-sectioning to determine tissue-specific expression patterns .

  • Translational fusions with fluorescent proteins: Creating translational fusions of SWEET11 with eGFP (enhanced green fluorescent protein) under the control of the native promoter for confocal microscopy visualization .

  • Immunocytochemistry coupled with TEM: This approach allows for high-resolution subcellular localization of SWEET11 protein .

  • Laser capture microdissection combined with microarray analysis: This technique has proven effective in analyzing the expression of SWEET genes in specific tissues of seeds .

  • Live-cell imaging: This technique can be used to observe the dynamic localization of SWEET11-fluorescent protein fusions in living plant tissues .

What is the role of SWEET11 in seed development and filling?

SWEET11 plays a crucial role in seed development and filling in Arabidopsis, functioning as part of a cascade of sequentially expressed SWEET transporters (SWEET11, SWEET12, and SWEET15) . This cascade provides the feeding pathway for the plant embryo, which is critical for yield potential .

In seed development:

  • SWEET11 is expressed in the endosperm and seed coat during the linear cotyledon and maturation green stages .

  • It facilitates sucrose efflux from the seed coat and endosperm to supply the developing embryo with phloem-derived sugar .

  • The triple mutant sweet11;12;15 shows severe seed defects, including retarded embryo development, reduced seed weight, and reduced starch and lipid content, resulting in a "wrinkled" seed phenotype .

  • In sweet11;12;15 mutants, starch accumulates in the seed coat but not the embryo, implicating SWEET-mediated sucrose efflux in the transfer of sugars from seed coat to embryo .

How does SWEET11 function in phloem loading?

SWEET11, together with SWEET12, plays a key role in apoplasmic phloem loading, which is the process of transferring sucrose from photosynthetic cells to the phloem for long-distance transport .

The process involves:

  • SWEET11 and SWEET12 are localized to the plasma membrane of phloem parenchyma (PP) cells .

  • These transporters facilitate the efflux of sucrose from PP cells into the apoplast (cell wall space) .

  • Once in the apoplast, sucrose is taken up by companion cells through proton-coupled sucrose transporters (SUTs/SUCs) .

  • This two-step process enables the long-distance transport of sugar from leaves to non-photosynthetic sink tissues .

This was the first evidence that SWEET transporters serve as carbohydrate efflux carriers playing a key role in the export of sucrose to the phloem apoplast .

What is the relationship between SWEET11 and plant-pathogen interactions?

SWEET11 and SWEET12 have been implicated in plant-pathogen interactions, particularly in altering sugar levels at the site of pathogen infection . These transporters may supply nutrients to pathogens, as observed in other SWEET family members:

  • Several Clade III SWEETs, including SWEET10a in cassava (Manihot esculenta), play important roles in pathogen susceptibility .

  • Pathogens can manipulate SWEET expression to access plant sugars as an energy source .

  • Studies have shown roles for AtSWEET11 and AtSWEET12 during interactions with various pathogens, including work by Chen et al. (2010), Gebauer et al. (2016), and Walerowski et al. (2018) .

Understanding these interactions has important implications for developing strategies to enhance plant resistance to pathogens by potentially modifying SWEET transporter function or regulation.

How do SWEET11 and SWEET12 function synergistically in Arabidopsis?

SWEET11 and SWEET12 share approximately 88% amino acid similarity and function synergistically in several physiological processes :

  • Phloem loading: Together, they facilitate sucrose efflux from phloem parenchyma cells into the apoplast for subsequent uptake by proton-coupled transporters .

  • Seed filling: Both transporters contribute to supplying sucrose to developing seeds, although their expression patterns in seeds differ slightly (SWEET11 is more abundant in the endosperm while SWEET12 is more abundant in the seed coat) .

  • Xylem development: SWEET11 and SWEET12 have been implicated in xylem development processes .

  • Response to pathogens: Both transporters function in altering sugar flux in response to pathogen challenges .

The synergistic nature of these transporters is evidenced by the fact that single mutants often show minimal phenotypes, while double mutants exhibit more pronounced defects in these processes .

What is known about the substrate specificity and transport kinetics of SWEET11?

SWEET11 is primarily a sucrose transporter but exhibits substrate flexibility:

  • It can transport glucose and fructose in addition to sucrose .

  • It functions as a bidirectional transporter (uniporter) that facilitates diffusion along concentration gradients .

  • Transport activity is pH-independent, confirming the uniporter mechanism rather than proton coupling .

  • While specific kinetic parameters for SWEET11 are not directly provided in the search results, SWEET12 (which shares 88% similarity) has been characterized as a low-affinity sucrose transporter with a Km for sucrose uptake of ~70 mM and a Km for sucrose efflux of ~10 mM .

Molecular docking studies have identified specific residues (S22, S56, W60, N77, N197, W181, S177, V146, and S143) that interact with sucrose in the sugar-binding pocket of SWEET11 .

What are the recommended protocols for working with recombinant SWEET11 protein?

Based on the information about commercially available recombinant SWEET11 , the following protocols are recommended when working with the protein:

Storage and Handling:

  • Store at -20°C for regular use or -80°C for extended storage

  • Avoid repeated freezing and thawing cycles

  • Store working aliquots at 4°C for up to one week

  • The protein is typically supplied in a Tris-based buffer with 50% glycerol

Expression and Purification Considerations:

  • The full-length protein consists of 289 amino acids

  • The tag type will typically be determined during the production process

  • For experimental applications, researchers should consider the buffer compatibility with their specific assays

Potential Applications:

  • Structural studies (crystallography, cryo-EM)

  • Binding assays to characterize substrate interactions

  • Antibody production and validation

  • Functional reconstitution in artificial membrane systems

What experimental approaches are most effective for studying SWEET11 function in planta?

Several experimental approaches have proven effective for studying SWEET11 function in plants:

  • Genetic approaches:

    • Generation and characterization of single, double, and triple mutants (e.g., sweet11, sweet11;12, sweet11;12;15)

    • Complementation studies with native or modified SWEET11 constructs

    • CRISPR/Cas9 genome editing for precise modification of SWEET11 sequence or regulatory elements

  • Imaging techniques:

    • Fluorescent protein fusions for live-cell imaging and subcellular localization

    • Histochemical analysis using promoter-reporter (GUS) fusions

    • Transmission electron microscopy coupled with immunogold labeling

  • Physiological and biochemical analyses:

    • Measuring sucrose transport in various tissues

    • Analysis of starch and lipid content in seeds of wild-type versus mutant plants

    • Evaluation of phloem loading efficiency and sugar distribution

  • Expression analyses:

    • Laser capture microdissection combined with microarray or RNA-seq analysis

    • Quantitative RT-PCR to measure expression levels in different tissues and conditions

    • In situ hybridization for tissue-specific expression patterns

How can structural biology approaches enhance our understanding of SWEET11 function?

Structural biology approaches can significantly advance our understanding of SWEET11 function in several ways:

  • X-ray crystallography and cryo-EM: These techniques can reveal the three-dimensional structure of SWEET11, as has been done for related transporters like VsSemiSWEET and LbSemiSWEET . Understanding the structure would provide insights into the transport mechanism and substrate binding sites.

  • Molecular docking and simulation studies: Computational approaches have already identified the potential sucrose binding pocket in SWEET11 . Further molecular dynamics simulations could reveal conformational changes during transport.

  • Structure-guided mutagenesis: Based on structural information, targeted mutations can be introduced to test the functional importance of specific residues in transport activity.

  • Protein-protein interaction studies: Structural knowledge can guide investigations into how SWEET11 might interact with other proteins involved in sugar transport or regulation.

The search results indicate that molecular docking studies have identified residues involved in sucrose binding (S22, S56, W60, N77, N197, W181, S177, V146, and S143) , providing a foundation for further structural investigations.

What are the current hypotheses regarding the evolution of the SWEET family and SWEET11's position within it?

Based on the search results, several insights about SWEET evolution can be extracted:

  • Evolutionary duplication: SWEETs contain evolutionarily duplicated domains that individually and post-transcriptionally control SWEET expression . This duplication event has been important in the functional specialization of different SWEET transporters.

  • Conservation across kingdoms: SWEET transporters are found widely across biological kingdoms, from Archaea to higher plants and humans , suggesting an ancient origin for these sugar transporters.

  • Phylogenetic relationships: While specific details about SWEET11's phylogenetic position are not extensively detailed in the search results, there is mention of phylogenetic analyses of AtSWEET11 and AtSWEET12 orthologs from economically important crops .

  • Functional diversification: Different SWEET family members have specialized for various roles in plant biology, including phloem loading (SWEET11, SWEET12), seed filling (SWEET11, SWEET12, SWEET15), pollen nutrition, nectar secretion, and responses to biotic and abiotic stresses .

Current hypotheses likely center on how gene duplication and subsequent functional divergence have shaped the specialization of different SWEET transporters for distinct physiological roles in plants.

What are the promising applications of SWEET11 research for improving crop yield and stress resistance?

Research on SWEET11 and related transporters holds significant potential for agricultural applications:

These applications would require precise genetic engineering approaches and thorough understanding of SWEET11 regulation in diverse plant species of agricultural importance.

What methodological gaps exist in current SWEET11 research?

Several methodological challenges and research gaps exist in the current understanding of SWEET11:

  • Real-time sugar transport visualization: Developing methods to visualize sucrose movement in real-time within plant tissues would enhance our understanding of SWEET11 function in vivo.

  • High-resolution structures of plant SWEETs: While structures exist for bacterial SemiSWEETs , high-resolution structures of plant SWEET transporters, including SWEET11, would significantly advance the field.

  • Temporal regulation understanding: Better methods to understand how SWEET11 expression and activity are regulated during development and in response to environmental cues are needed.

  • Tissue-specific manipulation: Developing more precise tools for tissue-specific modification of SWEET11 function would help dissect its role in different plant tissues without pleiotropic effects.

  • Integration with metabolic networks: Methods to understand how SWEET11-mediated sugar transport integrates with broader metabolic networks in plants remain limited.

Addressing these methodological gaps would significantly advance our understanding of SWEET11 function and potentially open new avenues for agricultural applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.