Recombinant Arabidopsis thaliana Bidirectional sugar transporter SWEET12 (SWEET12)

Shipped with Ice Packs
In Stock

Description

Physiological Roles

SWEET12 operates redundantly with SWEET11 to regulate sucrose flux in Arabidopsis:

  • Phloem Loading: Double mutants (sweet11/sweet12) exhibit impaired sucrose export, leading to leaf sugar accumulation and growth defects .

  • Seed Filling: Facilitates sucrose efflux into seed apoplasts for embryo nutrition .

  • Pathogen Interactions: SWEET12 induction at infection sites alters sugar availability, modulating salicylic acid (SA)-dependent defense priming .

Table 2: Functional Redundancy of SWEET11 and SWEET12

ProcessSWEET11 RoleSWEET12 Role
Phloem LoadingPrimary transporterSecondary support
Seed DevelopmentMajor contributorMinor contributor
Pathogen ResponseLess inducedStrongly induced at infection sites

Recombinant Production and Applications

Recombinant SWEET12 is produced in heterologous systems (E. coli, yeast, mammalian cells) with ≥85% purity . Key applications include:

  • Functional Studies: Used in sucrose transport assays via FRET-based sensors or radiolabeled tracers .

  • Antibody Development: Rabbit polyclonal antibodies against SWEET12 enable detection in ELISA and Western blot .

Regulatory and Evolutionary Insights

  • Phylogenetic Analysis: SWEET12 orthologs exist in 39 plant species, including rice (OsSWEET12) and grapevine, highlighting conserved roles in sugar allocation .

  • Cis-Regulatory Elements: Promoter regions contain stress-responsive motifs (e.g., ABA, light-responsive elements), linking SWEET12 to environmental adaptation .

Pathogen Susceptibility and Defense Priming

  • sweet11/sweet12 double mutants show enhanced resistance to Colletotrichum higginsianum due to elevated leaf hexoses/sucrose, which activate SA-dependent defenses .

  • SWEET12 induction during infection does not directly fuel pathogens but alters host carbohydrate dynamics to prime immunity .

Biotechnological Potential

  • Crop Improvement: Engineering SWEET12 orthologs could optimize sugar allocation in economically important crops (e.g., rice, wheat) .

  • Disease Resistance: Targeting SWEET12 expression may reduce pathogen susceptibility without compromising growth .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will prepare accordingly.
Lead Time
Delivery times may vary based on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
SWEET12; MTN3; At5g23660; MQM1.8; Bidirectional sugar transporter SWEET12; AtSWEET12; MtN3-like protein; Protein SUGARS WILL EVENTUALLY BE EXPORTED TRANSPORTERS 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SWEET12
Target Protein Sequence
MALFDTHNTWAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSIPYVVALFSAMLW LYYATQKKDVFLLVTINSFGCFIETIYISIFVAFASKKARMLTVKLLLLMNFGGFCLILL LCQFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVI WLLYGLALKDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSDLVEKELEAAKLPEVSIDM VKLGTLTSPEPVAITVVRSVNTCNCNDRNAEIENGQGVRNSAATT
Uniprot No.

Target Background

Function
This protein mediates both low-affinity uptake and efflux of sugar across the plasma membrane. It is involved in phloem loading by mediating export from parenchyma cells, which in turn fuels H(+)-coupled import into the sieve element/companion cell complex. This process contributes to the sucrose migration from synthesis sites in the mesophyll to the phloem. Additionally, it plays a role in seed filling by triggering sucrose efflux involved in the transfer of sugars from the seed coat to the embryos.
Database Links

KEGG: ath:AT5G23660

STRING: 3702.AT5G23660.1

UniGene: At.24303

Protein Families
SWEET sugar transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in leaves, especially in phloem. Expressed in developing seeds.

Q&A

What is the molecular structure of SWEET12 and how does it differ from other sugar transporters?

SWEET12 belongs to the MtN3/saliva family and consists of seven α-helical transmembrane domains (TMs): a tandem repeat of three transmembrane domains connected with a linker-inversion TM . Molecular docking studies reveal that residues S22, S56, W60, N77, N197, W181, S177, V146, and S143 in SWEET12 interact with sucrose during transport . These interactions occur in a central cavity located in the middle of the transmembrane region, allowing alternate access to sucrose from either side of the membrane . Unlike active transporters that require energy, SWEET12 functions as a uniporter (facilitating diffusion) with transport activity that is pH-independent .

What is the transport mechanism and substrate specificity of SWEET12?

SWEET12 is a bidirectional transporter that facilitates the diffusion of sucrose molecules down concentration gradients . Kinetic studies have characterized SWEET12 as a low-affinity sucrose transporter with a Km of approximately 70 mM for sucrose uptake and 10 mM for efflux . While primarily transporting sucrose, SWEET12 exhibits substrate flexibility and can also transport glucose and fructose . The bidirectional nature of SWEET12 means its transport direction can reverse based on the prevailing sucrose concentration gradient, allowing it to function either as an importer or exporter depending on physiological conditions .

How do SWEET11 and SWEET12 function together in Arabidopsis?

SWEET11 and SWEET12 share approximately 88% amino acid similarity and function synergistically in multiple physiological processes . Both transporters are plasma membrane-localized and expressed in various tissues including leaves, roots, seeds, siliques, and flowers . They participate in pivotal processes such as phloem loading, xylem development, and seed filling . The high degree of functional redundancy is demonstrated by the fact that single mutants often show mild phenotypes, while double mutants exhibit more pronounced defects in sugar transport and allocation . This synergistic action optimizes sugar flux in response to varying environmental conditions .

What expression systems are most effective for producing functional recombinant SWEET12?

For functional expression of SWEET12, heterologous systems like Xenopus oocytes have proven effective for characterization of transport properties . When designing expression constructs, researchers should consider:

  • Adding fluorescent protein tags (GFP, YFP) for localization studies while ensuring these don't interfere with transport function

  • Including appropriate plant-optimized promoters for expression level control

  • Using codon optimization for the target expression system

  • Incorporating purification tags that can be cleaved if necessary for functional studies

Verification of functional activity should involve transport assays using radiolabeled or fluorescently labeled sucrose, with appropriate controls including non-functional mutant versions of the protein .

What methods are recommended for studying SWEET12 function in planta?

Several complementary approaches can effectively investigate SWEET12 function in plants:

  • Genetic approaches: Utilize T-DNA insertion mutants in combination with SWEET11 mutants to create double knockouts . CRISPR/Cas9 gene editing can create precise mutations to study specific amino acid contributions.

  • Expression analysis: RT-qPCR quantification of SWEET12 transcripts in different tissues and under various conditions provides insights into regulatory patterns . When performing RT-qPCR, reference genes like Actin should be carefully selected for normalization .

  • Subcellular localization: Fluorescent protein fusions combined with confocal microscopy can confirm plasma membrane localization and potential redistribution under stress conditions .

  • Sugar transport tracking: Methods like esculin (a fluorescent sucrose analog) translocation assays can visualize transport dynamics in different tissues .

  • Metabolite analysis: Quantification of sugar levels in different tissues of wild-type versus mutant plants helps assess transport efficiency .

For in vitro conditions, comparing nutrient uptake and sugar flow patterns between wild-type and mutant lines can reveal condition-specific functions of SWEET12 .

How can researchers differentiate SWEET12-specific transport from other sugar transporters?

Distinguishing SWEET12-specific transport from other transporters requires multiple complementary approaches:

  • Genetic strategies: Use sweet11/sweet12 double mutants complemented with SWEET12-specific constructs under native or tissue-specific promoters .

  • Substrate specificity: Exploit the low-affinity nature of SWEET12 (Km ~70mM for uptake) versus higher-affinity SUC/SUT transporters in experimental designs .

  • Directionality assessment: Design experiments that measure bidirectional transport capabilities, as SWEET12 facilitates both influx and efflux depending on concentration gradients .

  • Inhibitor studies: Apply transporter-specific inhibitors when available to block activity of particular transporter classes.

  • Expression pattern analysis: Combine with detailed tissue-specific expression studies to correlate transport activity with known expression patterns of SWEET12 .

This multi-faceted approach helps overcome the challenge of functional redundancy among sugar transporters.

What are the key physiological functions of SWEET12 in plant development?

SWEET12 plays essential roles in several developmental and physiological processes:

These diverse roles highlight SWEET12's central importance in plant sugar homeostasis and resource allocation.

How does SWEET12 function change under different environmental stresses?

SWEET12 exhibits dynamic responses to various environmental stresses:

  • Cold stress: sweet11/sweet12 double mutants show enhanced freezing tolerance, suggesting altered sugar distribution patterns contribute to cold acclimation . This freezing tolerance phenotype implies SWEET12 may normally limit sugar accumulation that could otherwise enhance stress protection .

  • Pathogen responses: Sugar accumulation in sweet11/sweet12 double mutants enhances priming of salicylic acid-mediated defense responses . SWEET12 may be targeted by pathogens to alter sugar distribution at infection sites .

  • Nutrient availability: Under different growth conditions (in vitro vs. ex vitro), SWEET12's role in sugar transport between roots and leaves may be modified to optimize resource allocation .

  • Source-sink balance: Environmental factors that alter source-sink dynamics affect the direction and magnitude of SWEET12-mediated sucrose transport due to its bidirectional capabilities .

These stress-responsive functions highlight SWEET12's importance in plant adaptation to changing environmental conditions.

What phenotypes characterize sweet12 mutants compared to wild-type plants?

The phenotypic analysis of sweet12 mutants reveals:

The more severe phenotypes in double mutants confirm the functional redundancy between SWEET11 and SWEET12 and their synergistic roles in plant development and stress responses.

What molecular mechanisms determine substrate specificity in SWEET12?

The substrate specificity of SWEET12 is determined by specific structural features:

  • Key binding residues: Molecular docking studies identified residues S22, S56, W60, N77, N197, W181, S177, V146, and S143 that interact with sucrose in the binding pocket . These interactions determine transport selectivity and efficiency.

  • Substrate flexibility determinants: The ability of SWEET12 to transport not only sucrose but also glucose and fructose suggests a flexible binding pocket architecture .

  • Conserved residues: Val145 has been identified as a key residue conferring selectivity for both sucrose and other substrates . Replacing Val145 with Leucine reduces both sucrose and gibberellin transport activities .

  • Transmembrane arrangement: The arrangement of the seven transmembrane domains creates a central cavity that forms the substrate transport pathway, allowing bidirectional transport .

Understanding these molecular determinants provides insights into how SWEET12 achieves its selective yet flexible transport capabilities.

How is SWEET12 expression regulated at transcriptional and post-translational levels?

SWEET12 regulation occurs at multiple levels:

  • Transcriptional regulation:

    • Tissue-specific expression patterns are observed across leaves, roots, seeds, siliques, and flowers .

    • Environmental factors and developmental stages influence expression levels .

    • Potential cis-acting elements in the promoter region respond to developmental and environmental signals .

  • Post-translational regulation:

    • Subcellular localization to the plasma membrane is crucial for function .

    • Potential phosphorylation and other post-translational modifications may regulate activity.

    • Protein-protein interactions could modulate transport activity under different conditions.

  • Condition-dependent regulation:

    • Expression patterns differ between in vitro and ex vitro conditions, with more pronounced expression in roots under in vitro conditions .

    • Source-sink relationships affect expression and activity levels to optimize sugar distribution .

This multi-level regulation enables dynamic control of SWEET12 function in response to changing plant needs.

How do SWEET11 and SWEET12 coordinate with SUC/SUT transporters in phloem loading?

The coordination between SWEETs and SUC/SUT transporters in phloem loading involves a sophisticated spatial and functional relationship:

  • Spatial coordination: SWEET11 and SWEET12 localize to the plasma membrane of phloem parenchyma cells, while SUC/SUT transporters localize to companion cells and sieve elements .

  • Functional synergy: SWEETs facilitate sucrose efflux from mesophyll and phloem parenchyma cells into the apoplast, creating a sucrose pool that is then actively imported into the phloem by SUC/SUT transporters using proton symport .

  • Affinity complementation: SWEET12 functions as a low-affinity transporter (Km ~70mM), while SUC/SUT transporters typically have higher affinity for sucrose, creating an efficient transport system across concentration gradients .

  • Regulatory coordination: Expression of these transporters is likely coordinated to maintain efficient phloem loading under various conditions, though the exact molecular mechanisms remain to be fully elucidated.

This coordinated system enables efficient long-distance transport of photosynthetically derived sucrose from source to sink tissues.

What structural mutations could enhance or modify SWEET12 transport capabilities?

Strategic mutations could alter SWEET12 function in several ways:

  • Binding pocket modifications:

    • Mutations in key residues like S22, S56, W60, N77, N197, W181, S177, V146, and S143 could alter substrate specificity or affinity .

    • The S142N mutation appears to interfere with gibberellin transport while potentially maintaining sucrose transport capability .

    • V145 mutations affect both sucrose and gibberellin transport, indicating its critical role in substrate recognition .

  • Transport kinetics alterations:

    • Mutations at the substrate entry/exit points could modify transport rates.

    • Alterations to transmembrane domains may change conformational dynamics during the transport cycle.

  • Regulatory site modifications:

    • Targeting potential phosphorylation sites could create transporters with altered regulation patterns.

    • Mutations affecting protein-protein interaction sites might modify regulatory responses.

Systematic mutagenesis studies combined with functional assays would help identify modifications with beneficial effects for research or biotechnological applications.

How can SWEET12 research inform crop improvement strategies?

SWEET12 research has significant implications for crop improvement:

  • Yield enhancement: Manipulating SWEET orthologs in crops could optimize sugar allocation to harvestable tissues, potentially increasing yield . Phylogenetic and in-silico analyses of SWEET11 and SWEET12 orthologs from 39 economically important plant species provide platforms for such applications .

  • Stress resilience: Understanding how SWEET12 contributes to freezing tolerance and pathogen defense could inform strategies to enhance crop stress resilience . The enhanced freezing tolerance of sweet11/sweet12 mutants suggests targeted modification of these transporters could improve cold hardiness .

  • Source-sink relationships: Modifying SWEET12 activity could optimize source-sink relationships to enhance photosynthetic efficiency and carbon partitioning in crops .

  • Pathogen resistance: Since some pathogens target SWEET transporters to manipulate host sugar distribution, engineering pathogen-resistant variants could enhance disease resistance .

The conservation of SWEET transporters across plant species suggests that knowledge gained from Arabidopsis SWEET12 could be applied to improve diverse crops through gene editing or breeding approaches.

What are the most promising techniques for visualizing SWEET12 transport dynamics in real-time?

Advanced techniques for real-time visualization of SWEET12 transport include:

  • Fluorescent sucrose analogs: Using molecules like esculin combined with confocal microscopy to track sugar movement through tissues .

  • FRET-based sensors: Genetically encoded Förster Resonance Energy Transfer sensors can detect changes in sucrose concentrations in specific subcellular compartments in real-time.

  • Fluorescent protein fusions: SWEET12-FP fusions can be used to monitor protein localization changes in response to stimuli or stress conditions.

  • Bimolecular fluorescence complementation (BiFC): This technique can visualize protein-protein interactions involving SWEET12 in living cells.

  • Microfluidic devices: These can be combined with fluorescence techniques to monitor transport under controlled concentration gradients.

These advanced imaging approaches provide powerful tools for understanding the dynamic regulation and function of SWEET12 in plants, offering insights that static analytical methods cannot provide.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.