Recombinant Arabidopsis thaliana Bidirectional sugar transporter SWEET14 (SWEET14)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
SWEET14; At4g25010; F13M23.150; Bidirectional sugar transporter SWEET14; AtSWEET14; Protein SUGARS WILL EVENTUALLY BE EXPORTED TRANSPORTERS 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-281
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SWEET14
Target Protein Sequence
MVLTHNVLAVTFGVLGNIISFIVFLAPVPTFVRICKKKSIEGFESLPYVSALFSAMLWIY YALQKDGAGFLLITINAVGCFIETIYIILFITYANKKARISTLKVLGLLNFLGFAAIILV CELLTKGSNREKVLGGICVGFSVCVFAAPLSIMRVVIRTKSVEFMPFSLSLFLTISAITW LFYGLAIKDFYVALPNILGAFLGAVQMILYVIFKYYKTPLVVDETEKPKTVSDHSINMVK LSSTPASGDLTVQPQTNPDVSHPIKTHGGDLEDQMDKKMPN
Uniprot No.

Target Background

Function
This protein mediates both low-affinity uptake and efflux of sugars across the plasma membrane.
Gene References Into Functions
  1. Studies suggest that Arabidopsis thaliana SWEET proteins AtSWEET13 and AtSWEET14 may modulate gibberellin (GA) response. PMID: 27782132
Database Links

KEGG: ath:AT4G25010

STRING: 3702.AT4G25010.1

UniGene: At.54509

Protein Families
SWEET sugar transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is SWEET14 in Arabidopsis thaliana?

SWEET14 (AtSWEET14) is a member of the SWEET (Sugars Will Eventually be Exported Transporters) gene family in Arabidopsis thaliana. It functions as a bidirectional sugar transporter primarily involved in sucrose transport across plasma membranes. SWEET14 belongs to a conserved family of transporters that play crucial roles in plant physiology and development . Specifically, AtSWEET14 and its close paralog AtSWEET13 are expressed in anthers and associated with seed yield, capable of transporting both sucrose and gibberellic acid (GA), though recent evidence suggests sucrose transport is their primary biological function .

How does SWEET14 relate to other members of the SWEET family?

The Arabidopsis genome encodes approximately 20 SWEET paralogs categorized into four phylogenetic clades. While SWEET transporters from clades I, II, and IV predominantly transport hexoses, clade III members (which include some close relatives of SWEET14) preferentially transport sucrose . Understanding this classification helps researchers contextualize SWEET14's role within the broader sugar transport network in plants. SWEET14 shares functional redundancy with SWEET13, as demonstrated by genetic studies showing that single mutants have mild phenotypes while double mutants show significant reproductive defects .

What is the biological significance of SWEET14-mediated sugar transport?

AtSWEET14, along with AtSWEET13, plays a critical role in reproductive development in Arabidopsis. Research conclusively demonstrates that the sucrose transport function (rather than GA transport) of these proteins is vital for pollen viability and male fertility . Cross-sectional analyses and GUS reporter studies indicate that AtSWEET13/14 mediate sucrose release from the endothecium to the locule during late stages of anther development when the tapetum has degenerated . This sugar transport activity is essential for providing energy resources to developing pollen, directly impacting plant reproductive success.

What expression systems are effective for producing recombinant SWEET14?

For recombinant production of plant membrane proteins like SWEET14, the Arabidopsis-based super-expression system offers significant advantages. This homologous expression platform yields up to 0.4 mg of purified protein per gram fresh weight and ensures proper post-translational modifications and complex formation with endogenous interaction partners . This system is particularly valuable for membrane proteins like SWEET14 that may not fold properly in heterologous systems like E. coli. For functional studies, researchers can utilize the native Arabidopsis system under the control of either the native promoter or a strong constitutive promoter depending on experimental requirements.

How can I effectively study SWEET14 substrate specificity?

The substrate specificity of SWEET transporters can be investigated using innovative biosensor approaches. For example, the SweetTrac1 biosensor system (derived from the clade I AtSWEET1) translates substrate binding into detectable fluorescence changes . Similar approaches can be adapted for SWEET14 studies. Additionally, cheminformatics can be combined with small-molecule screening to identify potential substrates. Researchers should complement these approaches with cellular uptake assays using radiolabeled or fluorescently tagged sugars to confirm transport activity with identified candidate substrates .

What genetic tools are available for SWEET14 functional studies?

Several genetic resources facilitate SWEET14 research in Arabidopsis:

  • Traffic Lines (TLs): These transgenic stocks containing linked seed-specific eGFP and DsRed markers can be used to follow the inheritance of SWEET14 mutant alleles. With 163 traffic lines covering the Arabidopsis genome in overlapping intervals of approximately 1.2 Mb, researchers can track SWEET14 mutations through seed fluorescence without destructive genotyping .

  • TAIR Resources: The Arabidopsis Information Resource provides comprehensive genome annotation data, including SWEET14 information, supporting experimental design and data interpretation .

  • Complementation constructs: Genetic complementation using homologous or heterologous transporters (e.g., using AtSWEET9 which transports sucrose but not GA) under the control of the SWEET14 promoter can help dissect substrate specificity relevant to biological processes .

How do SWEET14 and SWEET13 coordinate sugar transport in reproductive tissues?

The functional redundancy between SWEET13 and SWEET14 presents both challenges and opportunities for researchers. Studies indicate that while single mutants show minimal phenotypic effects, the double mutant atsweet13;14 displays significant defects in pollen viability . This suggests a coordinated action of these transporters in reproductive tissues. Research methods to investigate this coordination include:

  • Tissue-specific expression analysis using reporter constructs

  • Cell-type specific complementation experiments

  • Temporal expression studies during anther development

  • Double-mutant phenotypic analysis using microscopy imaging and histochemical staining techniques

The results from cross-sectioning and GUS reporter lines suggest that AtSWEET13/14 coordinate sugar movement from the endothecium to the locule specifically during late anther development stages .

What is the structural basis for SWEET14 substrate recognition?

While direct structural data for SWEET14 is limited, insights can be gained from related transporters. SWEET transporters typically consist of an asymmetric pair of triple-helix bundles connected by an inversion linker transmembrane helix (TM4) that creates the translocation pathway . Structure-guided mutagenesis of close paralogs has identified key residues involved in substrate translocation and protomer interactions. The substrate recognition pocket in SWEET transporters can accommodate various sugar structures, including different furanoses, pyranoses, and acyclic sugars .

Table 1: Key Structural Features of SWEET Transporters Relevant to Substrate Recognition

Structural ElementFunctionRelevance to SWEET14
Triple-helix bundlesForms the core transport pathwayLikely conserved in SWEET14
TM4 inversion helixConnects the two triple-helix bundlesCritical for translocation mechanism
Substrate binding pocketRecognizes sugar structuresDetermines specificity for sucrose vs. GA
Protomer interfacesMediates oligomerizationImportant for transport regulation

How does SWEET14 activity interface with plant hormone signaling?

The dual transport capacity of SWEET14 for both sucrose and GA raises intriguing questions about the interface between sugar transport and hormone signaling. Research has demonstrated that while SWEET14 can transport GA in experimental systems, its biological function in pollen development primarily depends on sucrose transport . This was elegantly demonstrated through complementation experiments where AtSWEET9 (which transports sucrose but not GA) could rescue the atsweet13;14 phenotype, while the GA transporter AtNPF3.1 could not . Future research should investigate:

  • Whether SWEET14's GA transport capability has biological significance in other tissues or developmental contexts

  • Potential regulatory relationships between sugar availability and hormone signaling

  • How environmental stresses might alter the balance between these two transport functions

What are common challenges in SWEET14 expression studies and how can they be overcome?

Membrane protein expression and purification present several technical challenges:

  • Protein instability: Using the Arabidopsis super-expression system maintains the native cellular environment, improving stability and proper folding .

  • Low expression levels: The super-expression system can yield up to 0.4 mg purified protein per gram fresh weight, substantially higher than many heterologous systems .

  • Protein aggregation: Careful optimization of detergent types and concentrations during extraction is essential.

  • Maintaining functionality: Activity assays should be performed immediately after purification to confirm that the recombinant protein retains transport activity.

How can I validate SWEET14 substrate transport in vivo?

Multiple complementary approaches should be employed to validate substrate transport:

  • Genetic complementation: Test whether wild-type SWEET14 can rescue phenotypes of the sweet14 mutant or sweet13;sweet14 double mutant .

  • Transport assays: Measure uptake/efflux of radiolabeled substrates in plant tissues or heterologous expression systems.

  • Fluorescent biosensors: Adapt systems like SweetTrac1 to monitor SWEET14-substrate interactions through fluorescence changes .

  • Phenotypic analysis: Examine developmental phenotypes known to be associated with SWEET14 function, particularly focusing on pollen viability and germination using histochemical staining techniques .

How can I interpret contradictory results in SWEET14 functional studies?

When faced with contradictory results regarding SWEET14 function:

  • Consider genetic redundancy: The functional overlap between SWEET13 and SWEET14 may mask phenotypes in single mutants; always examine double mutants .

  • Evaluate expression context: The cellular location and developmental timing of expression can significantly impact functional outcomes.

  • Assess experimental conditions: Environmental factors such as light, temperature, and nutrient availability may influence SWEET14 function.

  • Verify knockout/knockdown efficiency: Incomplete gene silencing can lead to residual activity and confounding results.

  • Examine protein-protein interactions: SWEET14 may function differently depending on its interaction partners in different tissues or conditions.

What emerging technologies could advance SWEET14 research?

Several cutting-edge technologies promise to enhance our understanding of SWEET14:

  • Cryo-electron microscopy: This technique could reveal the detailed structure of SWEET14 in different conformational states, illuminating its transport mechanism.

  • Single-molecule tracking: Visualizing SWEET14 movement and clustering in plant cell membranes could provide insights into its regulation.

  • CRISPR-Cas9 genome editing: Precise modification of SWEET14 regulatory elements or coding sequences can help dissect its function with unprecedented precision.

  • Metabolomics integration: Combining SWEET14 functional studies with comprehensive metabolite profiling can reveal broader impacts on plant metabolism.

  • Artificial intelligence approaches: Machine learning models trained on TAIR's carefully curated functional annotation datasets could predict new aspects of SWEET14 function or regulation .

How might SWEET14 research contribute to broader plant biology understanding?

SWEET14 research extends beyond basic sugar transport mechanisms to several critical areas:

  • Plant-pathogen interactions: Several SWEET transporters are targets of pathogen effectors that manipulate host sugar transport; understanding if SWEET14 plays a role could reveal new disease resistance strategies.

  • Climate adaptation: Investigating how environmental stresses affect SWEET14 expression and function may reveal mechanisms of plant resilience.

  • Reproductive biology: The essential role of SWEET14 in pollen development provides insights into plant reproductive mechanisms that could be leveraged for crop improvement.

  • Hormone-sugar crosstalk: The dual transport capacity for sucrose and GA presents an intriguing model to study the integration of sugar and hormone signaling networks in plants .

What are the current limitations in our understanding of SWEET14 function?

Despite significant progress, several knowledge gaps remain:

  • The precise three-dimensional structure of SWEET14 and how it determines substrate specificity

  • The regulatory mechanisms controlling SWEET14 expression during development and stress responses

  • The full range of SWEET14 substrates beyond the currently identified sugars and hormones

  • The potential interactions between SWEET14 and other membrane proteins or signaling components

  • The evolutionary history of SWEET14 and how its function may differ across plant species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.