Recombinant Arabidopsis thaliana Bidirectional sugar transporter SWEET15 (SWEET15)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
SWEET15; SAG29; At5g13170; T19L5.130; Bidirectional sugar transporter SWEET15; AtSWEET15; Protein SUGARS WILL EVENTUALLY BE EXPORTED TRANSPORTERS 15; Senescence-associated protein 29
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SWEET15
Target Protein Sequence
MGVMINHHFLAFIFGILGNVISFLVFLAPVPTFYRIYKRKSTESFQSLPYQVSLFSCMLW LYYALIKKDAFLLITINSFGCVVETLYIAMFFAYATREKRISAMKLFIAMNVAFFSLILM VTHFVVKTPPLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEYMPFTLSFFLTISAV MWFAYGLFLNDICIAIPNVVGFVLGLLQMVLYLVYRNSNEKPEKINSSEQQLKSIVVMSP LGVSEVHPVVTESVDPLSEAVHHEDLSKVTKVEEPSIENGKCYVEATRPETV
Uniprot No.

Target Background

Function
This protein mediates both low-affinity uptake and efflux of sugars across the plasma membrane. It regulates cell viability under high salinity conditions and promotes senescence and sensitivity to salt stress. Furthermore, it contributes to seed filling by facilitating sucrose efflux, essential for sugar transfer from the seed coat to the embryo.
Gene References Into Functions
  1. SWEET11, SWEET12, and SWEET15 exhibit distinct spatiotemporal expression patterns in developing seeds. In later developmental stages, sucrose export from the outer integument is primarily mediated by SWEET15, and potentially by SWEET11 from the inner integument. [SWEET15] PMID: 25794936
  2. SAG29 protein may function as a molecular link integrating environmental stress responses into the senescence process. PMID: 20963606
Database Links

KEGG: ath:AT5G13170

STRING: 3702.AT5G13170.1

UniGene: At.46857

Protein Families
SWEET sugar transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus membrane.
Tissue Specificity
Accumulates in leaves during senescence, in a SA-independent manner. Expressed in the lateral roots and in flowers. Expressed in developing seeds.

Q&A

What is SWEET15 and how does it function in Arabidopsis thaliana?

SWEET15 is a member of the SWEET (Sugars Will Eventually be Exported Transporters) family in Arabidopsis thaliana. It functions as a bidirectional sugar transporter that facilitates the diffusion of sugars across cell membranes along concentration gradients. Unlike other sugar transporters such as MSTs and SUTs that couple with H+ for transport, SWEET proteins operate as uniporters/facilitators that can transport sugar in both directions independent of environmental pH values .

SWEET15 plays a crucial role in seed development, particularly in the transport of sucrose from maternal tissues to the developing embryo. It exhibits specific spatiotemporal expression patterns during seed development, with notable presence in the endosperm during globular and maturation green stages, and in the seed coat during linear cotyledon and maturation stages .

What is the expression pattern of SWEET15 during seed development?

SWEET15 shows a distinct developmental expression pattern throughout seed development:

  • Preglobular stage: Weak expression in seeds generally, but dominant expression in the epidermal cells of the seed coat

  • Globular stage: Expression in the endosperm, with diminishing expression in the seed coat

  • Heart stage: Continued reduced expression in the seed coat

  • Linear cotyledon stage: Strong reappearance in the seed coat and expression in the micropylar endosperm layer closest to the embryo

  • Maturation stage: Continued strong expression in the seed coat

This precise spatiotemporal regulation suggests SWEET15 plays specific roles at different developmental stages. Microarray data and confocal microscopy of SWEET15-eGFP fusions confirm this expression pattern, with SWEET15-eGFP detectable both at the plasma membrane and in intracellular puncta (likely Golgi bodies) .

How does SWEET15 contribute to embryo and seed development?

SWEET15 works in concert with SWEET11 and SWEET12 to facilitate sugar transport during seed development. While single mutants of each SWEET transporter show minimal developmental defects, the triple mutant (sweet11;12;15) displays severe seed abnormalities, indicating functional redundancy among these transporters .

The developmental impact becomes evident at the transition from globular to heart stage (around 4 days post anthesis), with the maximum difference observed around 8 DPA, coinciding with peak SWEET protein accumulation. The triple mutant embryos show significant developmental delays; at 6 DPA, while wild-type embryos reach the linear cotyledon stage, triple mutant embryos remain at the heart stage .

Notably, SWEET15 can largely rescue the delayed growth of the triple mutant embryos when expressed from its native promoter, suggesting its crucial role in seed development independent of phloem loading functions (which are primarily associated with SWEET11 and SWEET12) .

What phenotypes are associated with SWEET15 deficiency?

  • Retarded embryo development with developmental delays becoming apparent at the transition from globular to heart stage

  • Reduced seed weight (approximately 43% reduction in the triple mutant compared to wild type)

  • Reduced starch and lipid content in embryos leading to a characteristic "wrinkled" seed phenotype

  • Abnormal starch distribution, with increased accumulation in the seed coat but decreased content in the embryo

These phenotypes indicate that SWEET15, together with SWEET11 and SWEET12, is essential for proper sucrose efflux from maternal tissues and subsequent sugar transport to the developing embryo .

How is SWEET15 structurally organized and localized within cells?

SWEET15 belongs to the SWEET family of transporters, which function as bidirectional uniporters that facilitate sugar diffusion across membranes along concentration gradients. Structural analysis of related SWEET proteins indicates they can adopt three conformations: outward open, inward open, and occluded, which enable a rocking-type motion during transport .

Subcellular localization studies using SWEET15-eGFP fusion proteins reveal dual localization:

  • At the plasma membrane, consistent with its role in transporting sugars across cellular boundaries

  • In intracellular puncta, which are likely Golgi bodies as confirmed by transmission electron microscopy (TEM)

This dual localization pattern may reflect the protein trafficking pathway or suggests potential additional roles in intracellular sugar transport or compartmentalization.

What methodologies are most effective for studying SWEET15 function in sugar transport?

Several complementary approaches provide robust insights into SWEET15 function:

Genetic Approaches:

  • Generate single, double, and triple mutants using T-DNA insertion lines or CRISPR-Cas9

  • Perform complementation assays with fluorescent protein fusions to confirm functionality

  • Use tissue-specific promoters for targeted expression studies

Imaging Techniques:

  • Employ confocal microscopy with fluorescent protein fusions to determine subcellular localization

  • Utilize FRET sensors to monitor real-time sugar transport and concentration changes

  • Implement TEM for ultrastructural analysis of protein localization

Biochemical and Physiological Assays:

  • Measure seed weight, size, and number to quantify developmental effects

  • Analyze starch and lipid content to assess metabolic consequences

  • Perform sugar content analysis in different seed compartments

Expression Systems:

  • Express SWEET15 in heterologous systems (yeast, oocytes) to study transport properties

  • Use fluorescent glucose sensors in expression systems to detect transport activity

  • Implement liposome reconstitution assays to study transport in defined membrane environments

How do researchers differentiate between the roles of SWEET11, SWEET12, and SWEET15 in seed development?

Distinguishing the specific roles of these transporters requires multiple strategic approaches:

Spatiotemporal Expression Analysis:

  • Analyze gene expression patterns using promoter-reporter fusions

  • Track protein localization using fluorescent protein fusions

  • Compare expression timing across developmental stages

The search results reveal distinct expression patterns:

  • SWEET11: Primarily in endosperm and seed coat during linear cotyledon and maturation green stages

  • SWEET12: Most abundant in seed coat during linear cotyledon and maturation stages, also in suspensor and micropylar end of seed coat at globular stage

  • SWEET15: Present in endosperm during globular and maturation stages, dominant in seed coat during linear cotyledon and maturation stages

Genetic Dissection:

  • Analyze all combinations of mutants (single, double, triple)

  • Perform reciprocal crosses to distinguish maternal versus embryonic effects

  • Implement tissue-specific complementation to determine functional sites

Phenotypic Analysis:

  • Quantify developmental timing differences across mutant combinations

  • Measure sugar distribution in various seed tissues

  • Assess embryo size and seed weight across genotypes

GenotypeSeed Weight ReductionEmbryo Development
Wild-type-Normal progression
sweet11;12~23%Slightly delayed
sweet11;12;15~43%Severely retarded

What challenges exist in expressing and purifying recombinant SWEET15 for structural studies?

Membrane proteins like SWEET15 present several significant challenges for structural studies:

Expression System Selection:

  • Bacterial systems often struggle with eukaryotic membrane protein folding

  • Yeast systems may provide better folding but lower yields

  • Plant-based expression systems maintain native modifications but have lower yields

Solubilization and Stabilization:

  • Identifying optimal detergents that maintain protein structure and function

  • Developing nanodiscs or other membrane mimetics for native-like environments

  • Managing protein stability during purification steps

How can researchers analyze the substrate specificity of SWEET15 compared to other sugar transporters?

Determining SWEET15's substrate specificity requires multiple complementary approaches:

In vitro Transport Assays:

  • Heterologous expression in yeast or oocytes followed by uptake assays with different sugars

  • Competition assays with multiple sugars to determine relative affinities

  • Radiolabeled sugar transport measurements

FRET-based Approaches:

  • Use glucose FRET sensors to monitor substrate specificity in real-time

  • Implement intracellular sugar sensors to measure transport rates for different substrates

Mutagenesis Studies:

  • Identify and mutate potential substrate-binding residues

  • Create chimeric proteins with other SWEET transporters to determine specificity domains

  • Perform structure-guided mutagenesis once structural data becomes available

Computational Analysis:

  • Molecular docking simulations with different sugar substrates

  • Homology modeling based on related SWEET proteins with known structures

  • Molecular dynamics simulations to predict substrate interactions

What are the current hypotheses regarding the regulation of SWEET15 expression during seed development?

Multiple regulatory mechanisms likely control SWEET15 expression:

Developmental Programming:

  • Transcriptional regulation tied to specific seed development stages

  • Tissue-specific promoter elements driving expression in seed coat and endosperm

  • Potential feedback regulation from sugar concentrations

Hormone Signaling:

  • Possible regulation by plant hormones that control seed development

  • Integration with abscisic acid signaling during seed maturation

  • Potential crosstalk with auxin pathways during embryogenesis

Sugar Sensing:

  • Regulation in response to cellular or apoplastic sugar levels

  • Integration with other sugar-responsive genes during seed filling

  • Potential sensing of source-sink relationships during development

The precise sequential expression of SWEET11, SWEET12, and SWEET15 suggests a carefully orchestrated regulatory network that coordinates sugar transport throughout seed development .

What approaches are most effective for monitoring sugar distribution and transport in developing seeds?

Researchers can implement several complementary methods:

Non-invasive Imaging:

  • Implement FRET-based sugar sensors for real-time visualization

  • Use non-metabolizable fluorescent sugar analogs to track transport

  • Develop tissue-specific sensor expression for compartment-specific measurements

Biochemical Analysis:

  • Perform tissue-specific sugar extraction and quantification

  • Use radiolabeled sugars to track movement between compartments

  • Implement metabolite profiling across developmental stages

Genetic Tools:

  • Create reporter lines with sugar-responsive promoters

  • Utilize SWEET15 knockout and overexpression lines to monitor altered sugar distribution

  • Develop tissue-specific SWEET15 complementation lines to determine transport pathways

These approaches collectively provide a comprehensive view of sugar movement from maternal tissues to the embryo, helping elucidate the specific contribution of SWEET15 to this process.

How can researchers effectively generate and validate SWEET15 mutants and transgenic lines?

Generation of Knockout Lines:

  • CRISPR-Cas9 gene editing targeting conserved regions of SWEET15

  • T-DNA insertion lines from established collections

  • RNAi approaches for conditional knockdown

Validation Strategies:

  • PCR genotyping to confirm mutations

  • RT-qPCR to verify absence of transcript

  • Western blotting with specific antibodies

  • Complementation tests to ensure phenotypes are due to SWEET15 disruption

Transgenic Line Generation:

  • Use the native SWEET15 promoter for physiologically relevant expression

  • Include appropriate fluorescent or epitope tags that don't interfere with function

  • Create transgenics in the sweet11;12;15 background to test complementation

  • Employ site-directed mutagenesis to create functional variants

From the search results, we know that SWEET15-eGFP fusion proteins expressed under native promoters can complement the triple mutant phenotype, indicating the fusion protein maintains functionality .

What considerations are important when analyzing sweet15 mutant phenotypes in the context of redundancy with other transporters?

Several analytical approaches help address redundancy challenges:

Comprehensive Mutant Analysis:

  • Systematically analyze all combinations of single, double, and triple mutants

  • Quantify phenotypes using multiple parameters (seed weight, development timing, sugar content)

  • Consider maternal versus embryonic effects through reciprocal crosses

Temporal Considerations:

  • Analyze phenotypes across multiple developmental stages

  • Focus on the timing when SWEET15 expression is highest

  • Compare developmental delays between different mutant combinations

Tissue-Specific Effects:

  • Examine cell-type specific consequences of SWEET15 loss

  • Analyze sugar accumulation patterns in different seed compartments

  • Implement tissue-specific complementation to determine critical sites of action

From the search results, we know that while single sweet15 mutants show minimal phenotypes, the triple sweet11;12;15 mutants display severe developmental defects, highlighting the importance of analyzing multiple mutant combinations .

How can researchers interpret contradictory data regarding SWEET15 function?

When contradictory results arise, researchers should:

Standardize Experimental Conditions:

  • Ensure consistent growth conditions across experiments

  • Use identical genetic backgrounds for comparisons

  • Standardize developmental staging methods

Increase Experimental Robustness:

  • Implement sufficient biological and technical replication

  • Use independent mutant alleles to confirm phenotypes

  • Apply multiple methodological approaches to verify findings

Consider Contextual Factors:

  • Analyze environmental influences on phenotypes

  • Examine potential maternal effects through reciprocal crosses

  • Investigate potential compensation mechanisms in different backgrounds

Integrate Multiple Data Types:

  • Combine genetic, biochemical, and imaging approaches

  • Correlate transcriptomic with phenotypic data

  • Develop integrative models that account for redundancy and compensation

How might SWEET15 research inform approaches to improve crop yield and stress tolerance?

SWEET15's role in seed development suggests several translational applications:

Yield Enhancement:

  • Optimize SWEET expression to enhance seed filling in crops

  • Engineer improved sugar transport efficiency during seed development

  • Manipulate SWEET expression timing to extend the seed filling period

Stress Resilience:

  • Investigate SWEET15 regulation under drought or heat stress

  • Develop stress-resistant variants with maintained transport activity

  • Engineer stress-inducible expression to maintain seed filling under adverse conditions

The significant seed weight reduction (43%) in sweet11;12;15 triple mutants highlights the potential yield impacts of optimizing sugar transport during seed development .

What role might SWEET15 play in plant-pathogen interactions?

While the search results don't specifically address SWEET15 in pathogen interactions, research on related SWEET transporters suggests potential involvement:

Potential Mechanisms:

  • Pathogen exploitation of SWEET15 to access plant sugars

  • Pathogen effector-mediated manipulation of SWEET15 expression

  • Altered sugar distribution affecting defense responses

Research Approaches:

  • Monitor SWEET15 expression changes during pathogen challenge

  • Test susceptibility of sweet15 mutants to various pathogens

  • Examine if pathogens target SWEET15 regulation

The search results mention that other SWEET family members play important roles in pathogen susceptibility by potentially supplying nutrients to pathogens , suggesting SWEET15 might have similar functions in specific contexts.

How can systems biology approaches advance our understanding of SWEET15 function?

Integrative approaches provide comprehensive insights:

Multi-omics Integration:

  • Combine transcriptomic, proteomic, and metabolomic data

  • Correlate SWEET15 expression with global metabolic changes

  • Develop network models of sugar transport and metabolism during seed development

Computational Modeling:

  • Create mathematical models of sugar transport during seed filling

  • Simulate the effects of SWEET15 mutations on sugar distribution

  • Predict optimal expression patterns for enhanced seed development

Comparative Genomics:

  • Analyze SWEET15 conservation across species

  • Identify regulatory elements through comparative promoter analysis

  • Examine evolutionary patterns of SWEET family expansion and specialization

What cutting-edge technologies show promise for advancing SWEET15 research?

Several emerging methodologies offer new opportunities:

Single-Cell Approaches:

  • Single-cell RNA sequencing to reveal cell-type specific expression patterns

  • Single-cell metabolomics to track sugar distribution at cellular resolution

  • Cell-specific CRISPR editing for targeted functional analysis

Advanced Imaging:

  • Super-resolution microscopy for detailed subcellular localization

  • Light-sheet microscopy for 3D visualization of transport dynamics

  • Correlative light and electron microscopy for structure-function studies

CRISPR Technologies:

  • Base editing for precise modification of SWEET15 sequences

  • Prime editing for targeted nucleotide substitutions

  • CRISPR activation/repression systems for spatiotemporal regulation

Synthetic Biology:

  • Designer SWEET15 variants with altered transport properties

  • Synthetic regulatory circuits for controlled expression

  • Engineered sugar sensing and response systems

The database mentioned in the search results provides researchers with tools to more effectively analyze SWEET functions through targeted gene editing and simulation experiments , highlighting the importance of these emerging technologies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.