Recombinant Arabidopsis thaliana Bidirectional sugar transporter SWEET16 (SWEET16)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Plant Physiology

Overexpression of SWEET16 in Arabidopsis alters sugar dynamics and stress responses:

  • Sugar Homeostasis:

    • Reduced nocturnal accumulation of Glc, Fru, and Suc .

    • Impaired Fru accumulation under cold stress .

  • Stress Adaptation:

    • Enhanced freezing tolerance linked to elevated cytosolic Glc and Suc .

    • Improved nitrogen use efficiency under sufficient nitrate conditions .

  • Developmental Impacts:

    • Accelerated seed germination .

    • Biomass reduction under nitrogen-limited growth .

Table 2: Phenotypic Effects of SWEET16 Overexpression

ConditionWild-Type vs. 35SPro:SWEET16 LineKey Observations
Cold Stress↓ Fru in mutantsImpaired vacuolar Fru storage
Nitrogen Limitation↓ Glc/Fru in mutantsReduced growth efficiency
Standard Soil↑ Growth efficiencyEnhanced biomass

Applications of Recombinant SWEET16

Recombinant SWEET16 is critical for:

  • Agricultural Biotechnology: Engineering crops with improved stress tolerance or sugar partitioning .

  • Drug Discovery: Screening inhibitors/activators using ELISA-based systems (e.g., Anagnostics’ CSB-CF868035DOA kit) .

  • Basic Research: Resolving vacuolar sugar transport dynamics via isotopic tracer assays .

Challenges and Future Directions

While SWEET16 overexpression offers agronomic potential, tight regulation is essential to avoid trade-offs like reduced fitness under nutrient scarcity . Ongoing studies aim to:

  • Identify post-translational regulators (e.g., kinases) of SWEET16 activity .

  • Decipher tissue-specific roles in vascular parenchyma cells .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly specify them in your order remarks. We will prepare the product according to your demands.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
SWEET16; At3g16690; MGL6.16; Bidirectional sugar transporter SWEET16; AtSWEET16; Protein SUGARS WILL EVENTUALLY BE EXPORTED TRANSPORTERS 16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SWEET16
Target Protein Sequence
MADLSFYVGVIGNVISVLVFLSPVETFWRIVQRRSTEEYECFPYICTLMSSSLWTYYGIV TPGEYLVSTVNGFGALAESIYVLIFLFFVPKSRFLKTVVVVLALNVCFPVIAIAGTRTLF GDANSRSSSMGFICATLNIIMYGSPLSAIKTVVTTRSVQFMPFWLSFFLFLNGAIWGVYA LLLHDMFLLVPNGMGFFLGIMQLLIYAYYRNAEPIVEDEEGLIPNQPLLA
Uniprot No.

Target Background

Function
SWEET16 is a bidirectional sugar transporter that mediates both low-affinity uptake and efflux of sugars across the vacuolar membrane. It plays a crucial role in regulating sugar homeostasis in leaves and roots by exporting/importing sugars through the tonoplast according to metabolic demands. This protein acts as a vacuolar hexose transporter, facilitating the transport of sugars such as glucose (Glc), fructose (Fru), and sucrose (Suc).
Gene References Into Functions
  1. Research indicates that SWEET16 is a vacuolar sugar facilitator with a significant impact on various critical plant traits. This suggests that the activity of SWEET16 must be tightly regulated to enable optimal Arabidopsis development under challenging conditions. PMID: 24028846
Database Links

KEGG: ath:AT3G16690

STRING: 3702.AT3G16690.1

UniGene: At.27835

Protein Families
SWEET sugar transporter family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.
Tissue Specificity
Mostly expressed in the cortex of mature roots, and, to a lower extent, in aerial organs such as leaves, stems, and flowers. Mainly present in vascular parenchyma cells, especially in the petiole vasculature, flower stalks and at the base of individual, n

Q&A

What is SWEET16 and what is its primary function in Arabidopsis thaliana?

SWEET16 is a vacuole-located carrier that mediates both low-affinity uptake and efflux of sugars across the vacuolar membrane. It specifically transports glucose (Glc), fructose (Fru), and sucrose (Suc) as demonstrated through heterologous expression in Xenopus laevis oocytes . The primary function of SWEET16 is regulating sugar homeostasis in leaves and roots by exporting or importing sugars through the tonoplast in response to metabolic demands . This bidirectional transport activity is critical for maintaining appropriate sugar concentrations in different cellular compartments during various developmental stages and environmental conditions .

Research has demonstrated that SWEET16 belongs to a larger family of SWEET transporters, with its function being particularly specialized for vacuolar transport, distinguishing it from plasma membrane-localized family members . The transporter's activity significantly impacts various physiological processes, including germination efficiency, freezing tolerance, and nitrogen utilization .

Where is SWEET16 predominantly expressed in Arabidopsis thaliana tissues?

SWEET16 is predominantly expressed in vascular parenchyma cells, showing an expression pattern similar to its homolog SWEET17 . This localization is significant as vascular parenchyma cells play critical roles in nutrient transport and storage throughout the plant. The specific expression in these cells suggests that SWEET16 is strategically positioned to regulate sugar movement between vascular tissues and surrounding cells .

To study SWEET16 expression patterns, researchers typically employ techniques such as promoter-reporter gene fusions, in situ hybridization, and tissue-specific quantitative reverse transcription-PCR. These approaches have revealed that while the gene is primarily expressed in vascular tissues, its expression levels vary dynamically in response to environmental conditions and developmental stages .

How is SWEET16 expression regulated in response to environmental factors?

SWEET16 expression exhibits remarkable responsiveness to various environmental factors, particularly those that alter plant metabolism. Sugar application significantly impacts SWEET16 gene expression, with exogenous glucose, fructose, or sucrose dramatically decreasing SWEET16 mRNA levels to approximately 5-7% of control values . This negative feedback regulation suggests that high sugar levels reduce the need for additional sugar transport activity .

Temperature stress also influences SWEET16 expression. Incubation of leaf discs at 4°C downregulates SWEET16 mRNA to about 22% of control levels maintained at standard temperature (22°C) . Similarly, osmotic stress induced by mannitol and sodium chloride reduces SWEET16 mRNA levels by 45% and 23%, respectively .

Nitrogen availability plays a significant role in regulating SWEET16 expression. Plants grown under nitrogen-limiting conditions (0 mM) show the lowest SWEET16 expression, while increasing nitrogen concentrations (4 mM and 10 mM) lead to progressively higher SWEET16 mRNA levels . This pattern indicates that SWEET16 expression is integrated with the plant's nitrogen metabolism status, potentially helping coordinate carbon and nitrogen utilization .

What experimental systems have been used to characterize SWEET16 transport activity?

Several experimental approaches have been employed to characterize SWEET16 transport activity. The most definitive transport assays utilize heterologous expression in Xenopus laevis oocytes, where SWEET16 has been shown to transport glucose, fructose, and sucrose . This system allows researchers to isolate the transport function from other plant cellular processes and precisely measure substrate specificity and transport kinetics.

For in planta studies, researchers have generated SWEET16 overexpression lines (35SPro:SWEET16) to examine the transporter's function in its native context . These transgenic plants exhibit altered sugar accumulation patterns, particularly showing reduced glucose, fructose, and sucrose levels at the end of the night compared to wild-type plants . This approach reveals how increased SWEET16 activity affects whole-plant physiology and development.

Biochemical assays for measuring sugar content in different plant tissues and cellular compartments are essential for understanding SWEET16 function. These typically involve extraction procedures, followed by enzymatic assays or chromatographic methods to quantify specific sugars . By comparing sugar profiles between wild-type and genetically modified plants under various conditions, researchers can deduce the transporter's role in sugar partitioning.

How can researchers manipulate SWEET16 expression to study its function?

To study SWEET16 function, researchers have primarily used overexpression strategies. The creation of 35SPro:SWEET16 lines, where SWEET16 is expressed under the control of the constitutive 35S promoter, has been particularly informative . These plants show several phenotypic differences from wild-type, including altered sugar accumulation patterns, improved germination, increased freezing tolerance, and modified nitrogen use efficiency .

For experimental manipulation of SWEET16 expression, researchers should consider:

  • Vector construction: Using appropriate promoters (constitutive or inducible) to drive SWEET16 expression.

  • Transformation methods: Agrobacterium-mediated transformation is typically used for Arabidopsis.

  • Selection and verification: Confirming transgene integration and expression levels using PCR, quantitative RT-PCR, and western blotting.

  • Phenotypic analysis: Systematically analyzing growth, development, and stress responses under controlled conditions.

  • Tissue-specific expression: Using tissue-specific or inducible promoters to manipulate SWEET16 expression in specific cell types or developmental stages.

Complementary to overexpression, knockout or knockdown approaches using T-DNA insertion lines, CRISPR-Cas9 genome editing, or RNA interference can provide insights into the consequences of reduced SWEET16 activity. Comparing the phenotypes of plants with increased, decreased, or normal SWEET16 expression levels offers a comprehensive understanding of the transporter's function .

What methods are optimal for studying SWEET16 responses to different stresses?

To study SWEET16 responses to different stresses, researchers have implemented several effective methodologies. For cold stress experiments, plants are typically transferred to low-temperature conditions (4°C), followed by analysis of sugar accumulation patterns and SWEET16 expression levels . These studies have revealed that SWEET16 overexpressors are unable to accumulate fructose under cold conditions, suggesting a specific role for this transporter in cold stress responses .

For nitrogen stress studies, researchers grow plants in media with varying nitrogen concentrations (from 0 mM to 10 mM) and monitor growth parameters, biomass accumulation, and sugar profiles . Under limiting nitrogen conditions, wild-type plants accumulate more glucose, fructose, and sucrose in shoots compared to nitrogen-sufficient conditions, while SWEET16 overexpressors show significantly lower monosaccharide levels than wild-type plants .

Osmotic stress experiments typically involve treating leaf discs or whole plants with osmotica such as mannitol or sodium chloride, followed by analysis of SWEET16 expression and sugar transport activity . These approaches have shown that osmotic stress reduces SWEET16 mRNA levels, indicating that the transporter's activity is regulated in response to water availability .

How does SWEET16 overexpression impact plant stress tolerance mechanisms?

SWEET16 overexpression significantly alters plant stress tolerance, particularly for cold stress. 35SPro:SWEET16 lines demonstrated enhanced freezing tolerance compared to wild-type plants . This improved tolerance correlates with modified sugar levels, suggesting that glucose and sucrose may play superior roles in frost protection compared to fructose . The mechanism likely involves altered sugar partitioning between the cytosol and vacuole, affecting osmotic balance and cryoprotection capabilities .

The contrasting responses to different stresses highlight that SWEET16's impact on plant physiology is highly context-dependent. The consequences of increased SWEET16 activity depend on the type of external stimulus, suggesting that the transporter integrates multiple signaling pathways to fine-tune sugar allocation during stress responses .

What protein interactions are essential for SWEET16 function?

SWEET16 functions within a complex network of sugar transport and sensing proteins. STRING database analysis indicates several high-confidence protein-protein interactions that may be critical for SWEET16 function :

Protein PartnerScoreKnown Function
SUC40.783Sucrose transport protein responsible for sucrose uptake with proton symport
MSSP10.753Monosaccharide-sensing protein 1
ERDL60.742Sugar transporter ERD6-like 6
F12L6.160.738At2g39500/F12L6.16 protein
MSSP20.696Monosaccharide-sensing protein 2

The high interaction scores with other sugar transporters (SUC4, ERDL6) and sugar-sensing proteins (MSSP1, MSSP2) suggest that SWEET16 functions as part of a coordinated network regulating cellular sugar levels . The interaction with SUC4, a sucrose/proton symporter, is particularly intriguing as it suggests coordination between vacuolar and plasma membrane transport systems .

To investigate these interactions experimentally, researchers could employ techniques such as co-immunoprecipitation, yeast two-hybrid assays, or bimolecular fluorescence complementation. Understanding how these protein interactions are regulated under different conditions could provide insights into the molecular mechanisms of SWEET16-mediated sugar transport and its integration with cellular signaling networks.

How does SWEET16 activity influence other metabolic pathways in Arabidopsis?

SWEET16 activity has far-reaching effects on plant metabolism beyond simple sugar transport. By altering sugar partitioning between cellular compartments, SWEET16 influences various metabolic pathways and developmental processes . One of the most notable effects is on nitrogen metabolism. SWEET16 overexpressors show improved nitrogen use efficiency when nitrate is sufficiently available but reduced biomass under nitrogen limitation . This suggests that SWEET16-mediated sugar transport affects nitrogen assimilation and utilization pathways .

The inability of SWEET16 overexpressors to accumulate fructose under cold stress indicates that the transporter influences carbon allocation during temperature stress responses . This altered sugar distribution likely affects multiple downstream pathways, including those involved in cryoprotection, osmotic adjustment, and energy metabolism .

The improved germination observed in 35SPro:SWEET16 lines suggests that SWEET16 activity influences seed development and early seedling establishment . This phenotype may result from altered sugar availability during these critical developmental transitions, affecting both energy supply and signaling functions of sugars .

What are the implications of SWEET16 research for improving crop stress tolerance?

Research on SWEET16 has significant implications for developing stress-tolerant crops. The enhanced freezing tolerance observed in SWEET16 overexpressors suggests that manipulating sugar transport between cellular compartments could be a viable strategy for improving cold tolerance in crop plants . Similarly, the improved nitrogen use efficiency under certain conditions indicates potential for developing crops with better nutrient utilization capabilities .

Further research should focus on:

  • Identifying homologs of SWEET16 in crop species and characterizing their functions

  • Developing strategies for fine-tuning SWEET16 expression in response to specific environmental cues

  • Investigating how SWEET16-mediated sugar transport interacts with hormone signaling pathways during stress responses

  • Understanding the evolutionary conservation of SWEET16 function across different plant species

How can advanced imaging techniques enhance our understanding of SWEET16 dynamics?

Advanced imaging techniques offer powerful approaches for studying SWEET16 dynamics in living cells. Fluorescent protein fusions combined with confocal microscopy can reveal the subcellular localization and trafficking of SWEET16 under different conditions . These approaches could help resolve questions about how SWEET16 is targeted to the vacuolar membrane and whether its distribution changes in response to stresses.

Förster resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) techniques could be employed to visualize protein-protein interactions involving SWEET16 in vivo . These approaches would provide spatial and temporal information about how SWEET16 interacts with other components of sugar transport and sensing pathways.

Recently developed sensors for measuring sugar concentrations in different cellular compartments could be combined with SWEET16 studies to directly monitor how the transporter affects sugar fluxes in real-time. These sophisticated imaging approaches would provide unprecedented insights into the dynamics of SWEET16-mediated transport and its regulation in response to environmental signals.

What methodological challenges exist in studying vacuolar sugar transport?

Studying vacuolar sugar transport presents several methodological challenges. The internal location of the vacuole makes it difficult to access directly in living cells . Researchers often rely on isolated vacuoles or heterologous expression systems, which may not fully recapitulate the complex regulatory environment of intact plant cells .

Measuring sugar fluxes across the tonoplast requires specialized techniques. Researchers have used radiolabeled sugars, fluorescent sugar analogs, or genetically encoded sensors to track movement between compartments . Each approach has limitations in terms of sensitivity, specificity, or potential interference with native transport processes.

The bidirectional nature of SWEET16 transport adds complexity to functional studies . Determining the direction of transport under different conditions requires careful experimental design and interpretation. Future methodological developments might include:

  • Improved vacuole isolation techniques that better preserve transport properties

  • More sensitive and specific sensors for measuring subcellular sugar concentrations

  • Advanced electrophysiological methods for studying tonoplast transport in native contexts

  • Computational models that integrate transport kinetics with whole-cell metabolism

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.