Recombinant Arabidopsis thaliana Bidirectional sugar transporter SWEET17 (SWEET17)

Shipped with Ice Packs
In Stock

Description

Protein Properties

ParameterDetails
Gene IDSWEET17 (AT4G15920, DL4000C, FCAALL.237)
Host SystemsE. coli, yeast, baculovirus, mammalian cells
Purity≥85% (SDS-PAGE)
LocalizationTonoplast membrane in root and leaf cells
Transport ModeEnergy-independent uniporter (bidirectional)
SubstrateFructose (Fru); minimal activity for glucose/sucrose

Mechanistic Insights

SWEET17 facilitates diffusion-driven Fru transport without ATP dependence, as confirmed by insensitivity to metabolic inhibitors (e.g., NH₄Cl, carbonyl cyanide m-chlorophenyl hydrazone) . Its bidirectional activity allows dynamic regulation of cytosolic Fru levels, critical for metabolic homeostasis under stress .

Role in Vacuolar Fructose Transport

  • Root-Specific Expression: SWEET17 is predominantly expressed in root cortical cells, with tonoplast localization confirmed via GFP fusion studies .

  • Fru Inducibility: Expression is upregulated by exogenous fructose and darkness, conditions that trigger vacuolar Fru storage or release .

  • Phenotypic Impact:

    • sweet17 mutants show reduced lateral root (LR) growth under drought and impaired drought tolerance .

    • Overexpression reduces leaf Fru content by 80% during cold stress .

Drought Stress and Root Architecture

ConditionWild-Type (WT)sweet17 MutantSource
Fru SupplementationPR growth reduced by 50%PR growth reduced by 40%
Drought StressLR density ↑, stress tolerance ↑LR growth ↓, drought tolerance ↓

Shoot Branching and Reproductive Tolerance

  • SWEET17 mobilizes vacuolar Fru to support cauline branch emergence, particularly under drought stress .

  • sweet17 mutants exhibit reduced carbohydrate supply to siliques, impairing seed yield .

Stress Tolerance Engineering

Overexpression of SWEET17 homologs (e.g., DsSWEET17 from Dianthus spiculifolius) enhances salt, osmotic, and oxidative stress tolerance in Arabidopsis .

Stress TypeTransgenic ArabidopsisWild-TypeSource
Salt (125 mM NaCl)Root length ↑ by 25%Root length ↓
Osmotic (225 mM Mannitol)Root length ↑ by 20%Root length ↓

Sugar Metabolism Modulation

  • Overexpression increases root Fru accumulation and alters sucrose/glucose ratios, highlighting its role in carbohydrate partitioning .

Related Proteins and Functional Redundancy

  • SWEET16: A paralog in Arabidopsis clade IV, also involved in vacuolar Fru transport but with distinct root expression patterns .

  • DsSWEET17: A homolog from Dianthus spiculifolius that confers stress tolerance when expressed in Arabidopsis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SWEET17; At4g15920; dl4000c; FCAALL.237; Bidirectional sugar transporter SWEET17; AtSWEET17; Protein SUGARS WILL EVENTUALLY BE EXPORTED TRANSPORTERS 17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-241
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SWEET17
Target Protein Sequence
MAEASFYIGVIGNVISVLVFLSPVETFWKIVKRRSTEEYKSLPYICTLLGSSLWTYYGIV TPGEYLVSTVNGFGALVETIYVSLFLFYAPRHLKLKTVDVDAMLNVFFPIAAIVATRSAF EDEKMRSQSIGFISAGLNIIMYGSPLSAMKTVVTTKSVKYMPFWLSFFLFLNGAIWAVYA LLQHDVFLLVPNGVGFVFGTMQLILYGIYRNAKPVGLSNGLSEIAQDEEEGLTSRVEPLL S
Uniprot No.

Target Background

Function
SWEET17 acts as a vacuolar hexose transporter. It regulates fructose (Fru) homeostasis in leaves and roots by exporting/importing Fru through the tonoplast based on metabolic demand.
Gene References Into Functions
  1. SWEET17 plays a crucial role in facilitating bidirectional fructose (Fru) transport across the tonoplast of roots in response to metabolic demand to maintain cytosolic Fru homeostasis. PMID: 24381066
  2. The carrier protein SWEET17 is a significant factor controlling fructose content in Arabidopsis leaves. When SWEET17 expression is reduced, either through induction or natural variation, fructose accumulates in leaves, suggesting an enhanced storage capacity. PMID: 23583552
Database Links

KEGG: ath:AT4G15920

STRING: 3702.AT4G15920.1

UniGene: At.24131

Protein Families
SWEET sugar transporter family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in leaves at low levels, mostly in xylem and parenchyma. Highly expressed in the cortex of roots, predominantly in tips and mature regions, especially in tonoplasts. Accumulates also in cotyledons, stems, flowers, and siliques.

Q&A

What is SWEET17 and what is its primary function in Arabidopsis thaliana?

SWEET17 is a bidirectional sugar transporter that belongs to the SWEET (Sugars Will Eventually be Exported Transporters) family. It functions primarily as a vacuolar fructose facilitator that mediates both the import and export of fructose across the tonoplast (vacuolar membrane). Unlike most SWEET transporters that locate to the plasma membrane, SWEET17 is specifically localized to the tonoplast, along with SWEET2 and SWEET16 . The primary function of SWEET17 is to regulate fructose content in different plant tissues through facilitating fructose transport between the cytosol and vacuole in response to metabolic demands . This bidirectional transport capability allows SWEET17 to either sequester excess fructose in the vacuole or mobilize stored fructose from the vacuole to the cytosol when needed .

Where is SWEET17 predominantly expressed in Arabidopsis thaliana?

SWEET17 displays tissue-specific expression patterns in Arabidopsis thaliana. Quantitative reverse transcription PCR (qRT-PCR) analyses have revealed that SWEET17 is highly expressed in roots of young seedlings, which correlates with data from the Arabidopsis eFP Browser and Translatome database . In mature soil-grown plants, high SWEET17 expression is found in stems, flowers, and siliques, while expression remains comparatively low in both young and mature leaves . Within the stem, SWEET17 expression is specifically confined to the vasculature, and particularly high in the pith and cortex in areas where branches emerge from the inflorescence stem . This expression pattern indicates that SWEET17 may predominantly function in sink organs rather than source organs like mature leaves .

How do researchers differentiate between SWEET17 and other SWEET family transporters?

Researchers differentiate SWEET17 from other SWEET family transporters through several key characteristics:

  • Subcellular localization: Unlike most SWEETs that localize to the plasma membrane, SWEET17 localizes specifically to the tonoplast (vacuolar membrane), which can be visualized using SWEET17-GFP fusion proteins and confocal microscopy .

  • Substrate specificity: SWEET17 displays high specificity for fructose transport, whereas other SWEET transporters may transport glucose, sucrose, or other sugars. This specificity can be determined through heterologous expression systems and sugar uptake/efflux assays .

  • Expression patterns: SWEET17 has a distinct expression profile compared to other SWEET transporters, with particularly high expression in roots, stems, flowers, and siliques, but lower expression in leaves .

  • Mutant phenotypes: sweet17 knockout mutants show characteristic phenotypes including fructose accumulation and increased sensitivity to fructose toxicity, which differ from phenotypes observed in mutants of other SWEET transporters .

What phenotypes are observed in sweet17 knockout mutants?

The sweet17 knockout mutants display several distinct phenotypes that reveal the physiological functions of SWEET17:

  • Fructose accumulation: sweet17 mutants exhibit substantial accumulation of fructose in various tissues, particularly during drought stress. This accumulation occurs because SWEET17 normally functions as a vacuolar fructose exporter under unfavorable conditions, and its absence leads to fructose being trapped in the vacuole .

  • Altered carbohydrate profiles: Unlike fructose, sucrose contents are lower in stems, branches, flowers, and siliques of sweet17 mutants compared to wild-type plants under unstressed conditions. Additionally, sweet17 mutants show at least twice as high starch content in leaf tissue compared to wild types under both normal and stress conditions .

  • Increased sensitivity to fructose toxicity: Root growth in sweet17 mutants is significantly more sensitive to external fructose (1-2% w/v) compared to wild-type plants, suggesting that SWEET17 contributes to fructose tolerance in roots by facilitating vacuolar import of excess fructose .

  • Impaired branching under drought stress: sweet17 mutants develop fewer branches and have limited branch length under drought stress, resulting in lower seed yield per plant. This indicates that SWEET17 plays an important role in supporting shoot branching during stress conditions by mobilizing vacuolar fructose reserves to supply developing tissues .

How does SWEET17 contribute to drought stress responses in Arabidopsis?

SWEET17 plays a critical role in Arabidopsis drought stress responses through several mechanisms:

  • Carbohydrate mobilization: During drought stress, when sugar availability in sink tissues is limited due to impaired photosynthesis and reduced carbohydrate transport, SWEET17 increases the mobilization of sugars (particularly fructose) from vacuoles to maintain carbohydrate supply to developing tissues . This mobilization is especially important in the pith to support lateral bud formation and branch development.

  • Support for shoot branching: SWEET17 is highly expressed in areas of branch emergence in the inflorescence stem during drought stress. In wild-type plants, this expression facilitates fructose export from vacuoles to supply newly forming inflorescence branches, thereby maintaining efficient reproduction under stress conditions. The sweet17 mutants develop fewer branches with limited branch length under drought, resulting in reduced seed yield .

  • Prevention of toxic fructose accumulation: By exporting excess vacuolar fructose during stress conditions, SWEET17 helps prevent potential toxicity associated with high cellular fructose levels while making this carbohydrate available for essential metabolic processes .

  • Root system modulation: SWEET17 has been shown to be involved in fructose-stimulated modulation of the root system under drought stress, contributing to drought adaptation through optimized root architecture .

The AtSWEET17 gene expression exhibits strong induction upon drought stress across different tissues, indicating its importance in stress responses. Homologous genes of AtSWEET17 in other species are also upregulated in response to various environmental stressors, including salt, osmotic, and drought stress .

What is known about the structure-function relationship of SWEET17 and other SWEET transporters?

The structure-function relationship of SWEET17 and other SWEET transporters reveals important insights about their evolutionary origin and mechanism:

  • Evolutionary structure: SWEET transporters evolved from a more primitive 3-transmembrane domain (3-TM) structure found in prokaryotic SemiSWEETs. Eukaryotic SWEETs, including SWEET17, have a heptahelical structure consisting of 7 transmembrane domains (7-TM), which arose through internal duplication of the ancestral 3-TM unit separated by a single transmembrane domain .

  • Functional oligomerization: Research indicates that SWEETs, including SWEET17, homo- and heterooligomerize to form functional transport units. This has been demonstrated through split ubiquitin yeast two-hybrid and split GFP assays. Mutation studies show that defective SWEET variants can exert negative dominance when co-expressed with functional transporters, confirming that oligomerization is necessary for function .

  • Structural homology with MFS transporters: It has been hypothesized that the functional unit of SWEET family transporters possesses a structure resembling the 12-TM MFS (Major Facilitator Superfamily) structure, but with a parallel orientation of the 3-TM units rather than the series arrangement seen in MFS transporters .

  • Transport mechanism: Like other characterized SWEETs, SWEET17 mediates both influx and efflux of sugars at relatively low affinities, functioning as a uniporter that facilitates the diffusion of sugars (specifically fructose) across cell membranes down concentration gradients .

Understanding this structure-function relationship provides insight into how SWEET17 can act bidirectionally depending on cellular conditions and metabolic demands.

How does SWEET17 interact with sugar-regulated developmental pathways?

SWEET17 interacts with sugar-regulated developmental pathways through several interconnected mechanisms:

  • Branch development regulation: SWEET17 influences the expression of sugar-regulated branching and branch elongation regulators. This has been demonstrated through differential expression of these regulators in sweet17 mutants compared to wild-type plants, particularly under drought stress conditions .

  • Carbohydrate signaling: By controlling the flux of fructose between vacuolar storage and cytosolic availability, SWEET17 influences sugar signaling networks that regulate numerous developmental processes. The altered sugar profiles observed in sweet17 mutants (including changes in fructose, sucrose, and starch levels across different tissues) affect these signaling pathways .

  • Sink-source relationships: SWEET17 helps maintain appropriate sink-source relationships during development by facilitating sugar mobilization from storage compartments to developing tissues. This is particularly critical during stress conditions when photosynthetic carbon fixation and long-distance transport may be compromised .

  • Root development: SWEET17 has been shown to be critical for the initiation of lateral root formation, especially under drought stress conditions. This demonstrates how SWEET17-mediated sugar partitioning influences developmental programs in root architecture .

  • Reproductive development: The supporting role of SWEET17 in shoot branching directly affects reproductive capacity, as evidenced by reduced seed yield in sweet17 mutants. This connection highlights how sugar transport via SWEET17 impacts reproductive developmental programs .

Research using SWEET17 promoter-GUS fusions and tissue-specific expression analyses has been particularly valuable in elucidating these developmental connections, revealing how this transporter functions at the interface of metabolism and development.

What methodologies are most effective for studying SWEET17 transport kinetics?

Several methodologies have proven effective for studying SWEET17 transport kinetics:

  • Heterologous expression systems: Expression of SWEET17 in heterologous systems such as Xenopus oocytes or yeast allows for controlled measurement of transport activities. These systems provide a clean background for studying transport kinetics without interference from endogenous transporters .

  • Radiotracer uptake assays: Using radiolabeled fructose (e.g., 14C-fructose) to measure uptake and efflux rates in cells or membrane vesicles expressing SWEET17. This approach allows quantitative determination of transport rates and substrate affinities .

  • FRET-based sugar sensors: Fluorescence resonance energy transfer (FRET) sensors that detect changes in sugar concentrations can be used to measure real-time transport activity of SWEET17 in living cells.

  • Vacuole isolation and transport assays: Isolation of intact vacuoles from plants expressing or lacking SWEET17, followed by measurement of fructose transport across the tonoplast, provides direct evidence of transport function in the native membrane environment .

  • Electrophysiological techniques: Using techniques such as patch-clamp electrophysiology to measure transporter-mediated currents in response to substrate addition can provide detailed information about transport mechanisms and kinetics.

  • Genetic complementation approaches: Expressing SWEET17 in sweet17 mutant backgrounds and measuring restoration of phenotypes (such as fructose tolerance) provides functional validation of transport activity .

  • Biochemical analysis of sugar contents: Measuring sugar levels in different cellular compartments (e.g., vacuole vs. cytosol) in wild-type versus sweet17 mutant plants allows inference of transport activity over time and under different conditions .

These methodologies, particularly when used in combination, provide comprehensive characterization of SWEET17's transport properties, including substrate specificity, transport direction, and regulation under different conditions.

What considerations should be made when designing experiments to study SWEET17's role in drought response?

When designing experiments to study SWEET17's role in drought response, researchers should consider:

  • Drought application methods: Carefully control the timing, intensity, and uniformity of drought stress application. Consider using controlled soil moisture levels (e.g., maintaining soil at specific field capacity percentages) as demonstrated in studies showing SWEET17's role at 50% field capacity .

  • Tissue-specific analyses: Given SWEET17's differential expression across tissues, analyze responses in multiple organs separately (roots, stems, leaves, branches, flowers, siliques) rather than whole-plant measurements. This approach revealed critical tissue-specific functions of SWEET17 in stems and branches during drought .

  • Developmental timing: Consider the developmental stage of plants when applying drought stress, as SWEET17's role may differ between vegetative and reproductive growth phases. Studies show particular importance during reproductive development and branch emergence .

  • Comprehensive sugar profiling: Measure multiple carbohydrates (fructose, glucose, sucrose, starch) across different tissues to capture the full impact of SWEET17 on carbohydrate partitioning. This approach revealed that while fructose accumulates in sweet17 mutants, sucrose contents may decrease in certain tissues .

  • Gene expression analysis: Include quantitative analysis of SWEET17 expression alongside other drought-responsive genes and sugar-regulated genes to establish regulatory networks. RT-qPCR analysis has revealed strong induction of SWEET17 upon drought stress .

  • Proper genetic controls: Include multiple independent sweet17 mutant alleles (e.g., sweet17-1, sweet17-2) and complementation lines to ensure phenotypes are specifically due to SWEET17 dysfunction. Additionally, include SWEET17 overexpression lines to assess gain-of-function effects .

  • Histochemical approaches: Use promoter-reporter fusions (e.g., ProSWEET17:GUS) to visualize spatial and temporal expression patterns during drought stress progression. This approach revealed SWEET17 expression in specific stem tissues during branch emergence .

  • Recovery experiments: Include recovery phases after drought stress to assess SWEET17's role in stress recovery and resilience, not just stress tolerance.

  • Physiological measurements: Combine molecular analyses with physiological measurements (photosynthetic rate, transpiration, water potential) to connect SWEET17 function to whole-plant drought responses.

How can researchers effectively measure SWEET17 transport activity in planta?

Measuring SWEET17 transport activity in planta presents challenges due to the intracellular localization of this transporter. Effective approaches include:

  • Vacuole isolation and transport assays: Isolate intact vacuoles from Arabidopsis tissues and measure fructose uptake/efflux rates using radiolabeled substrates or sensitive analytical methods like HPLC. Compare transport rates between vacuoles isolated from wild-type plants versus sweet17 mutants .

  • Non-aqueous fractionation: Use non-aqueous fractionation techniques to separate subcellular compartments and quantify sugar distributions between vacuolar and cytosolic fractions in wild-type versus sweet17 mutant plants.

  • Tonoplast vesicles: Prepare purified tonoplast vesicles from plant tissues and measure substrate transport in vitro. This approach can be combined with recombinant expression of SWEET17 to control protein levels.

  • In vivo sugar sensors: Deploy subcellularly localized FRET-based sugar sensors to detect real-time changes in sugar concentrations within specific compartments. Target sensors specifically to the vacuole and cytosol to monitor fructose flux across the tonoplast.

  • Isotope labeling and flux analysis: Use stable isotope-labeled sugars (e.g., 13C-fructose) to track sugar movement between compartments over time, comparing flux rates between wild-type and sweet17 mutant plants.

  • Indirect phenotypic assays: Measure resistance to fructose toxicity as an indirect indicator of SWEET17 transport activity. Studies show that SWEET17 overexpression enhances tolerance to high external fructose, while sweet17 mutants show increased sensitivity .

  • Transgenic complementation with tagged variants: Complement sweet17 mutants with fluorescently tagged SWEET17 variants that allow simultaneous visualization of transporter localization and functional recovery.

  • Sugar accumulation kinetics: Analyze the kinetics of fructose accumulation or mobilization in different tissues following changes in environmental conditions (e.g., drought application or relief), comparing wild-type and sweet17 mutant responses .

These approaches, particularly when used in combination, can provide comprehensive insights into SWEET17's transport activity in the physiological context of the intact plant.

What genetic tools are most valuable for studying SWEET17 function?

Several genetic tools have proven particularly valuable for studying SWEET17 function:

  • T-DNA insertion mutants: Knockout lines like sweet17-1 and sweet17-2 with T-DNA insertions in the SWEET17 gene provide essential loss-of-function resources. These have revealed critical phenotypes including altered sugar accumulation patterns and increased sensitivity to fructose .

  • Overexpression lines: Transgenic lines overexpressing SWEET17 under constitutive promoters (e.g., 35S:SWEET17) demonstrate gain-of-function phenotypes, such as enhanced tolerance to high fructose conditions and altered sugar partitioning. These complement loss-of-function studies to establish functional relationships .

  • Promoter-reporter fusions: Transgenic lines carrying the SWEET17 promoter region fused to reporter genes like β-glucuronidase (ProSWEET17:GUS) or fluorescent proteins enable precise visualization of tissue-specific and condition-dependent expression patterns .

  • Protein fusion constructs: C-terminal translational GFP or GUS fusions of SWEET17 driven by native promoters allow simultaneous analysis of expression patterns, subcellular localization, and protein abundance across tissues and conditions .

  • CRISPR/Cas9 editing: Precise genome editing to introduce specific mutations in SWEET17 coding or regulatory regions, enabling structure-function studies or creation of variants with altered activity or regulation.

  • Tissue-specific expression systems: Using tissue-specific promoters to drive SWEET17 expression in select tissues to determine where SWEET17 function is necessary and sufficient for specific phenotypes.

  • Inducible expression systems: Employing chemically inducible promoters to control SWEET17 expression temporally, allowing for study of acute responses to SWEET17 activation or repression.

  • Split-ubiquitin yeast two-hybrid and split GFP assays: These systems have been successfully used to demonstrate that Arabidopsis SWEETs, including SWEET17, homo- and heterooligomerize, providing insights into functional transporter structure .

  • Negative dominance testing: Co-expression of defective SWEET variants with functional transporters to test for negative dominance effects, which has proven valuable for establishing the functional importance of oligomerization .

These genetic tools provide versatile approaches for dissecting SWEET17 function from molecular mechanisms to physiological roles in plant development and stress responses.

How can researchers reconcile apparent contradictions in SWEET17 functional data?

Researchers may encounter seemingly contradictory data regarding SWEET17 function. Here are methodological approaches to reconcile such contradictions:

By systematically addressing these factors, researchers can often resolve apparent contradictions and develop a more nuanced understanding of SWEET17's complex functions in plant biology.

What analytical approaches should be used to study SWEET17's impact on plant carbohydrate distribution?

To comprehensively analyze SWEET17's impact on plant carbohydrate distribution, researchers should employ several complementary analytical approaches:

  • Tissue-specific metabolite profiling: Quantify multiple carbohydrates (fructose, glucose, sucrose, starch) in carefully dissected tissues (leaves, stems, branches, flowers, siliques, roots) using methods like HPLC, GC-MS, or enzymatic assays. This approach revealed distinct sugar profiles across tissues in sweet17 mutants compared to wild-type plants .

  • Subcellular fractionation analysis: Separate vacuolar and cytosolic fractions using non-aqueous fractionation techniques to determine how SWEET17 affects sugar partitioning between cellular compartments. This is critical since SWEET17 specifically transports fructose across the tonoplast .

  • Flux analysis with labeled sugars: Use stable isotope-labeled sugars (13C) to track sugar movement between tissues and cellular compartments over time. Compare flux patterns between wild-type and sweet17 mutant plants to establish dynamic impacts on carbohydrate distribution.

  • Correlation network analysis: Apply statistical approaches like correlation network analysis to identify relationships between SWEET17 expression, sugar levels in different compartments, and physiological parameters. This helps establish causal relationships in complex datasets.

  • Multi-omics integration: Combine metabolomics data with transcriptomics and proteomics to understand how altered carbohydrate distribution affects broader cellular processes. This approach can reveal compensatory mechanisms and downstream effects of SWEET17 function .

  • Time-course experiments: Analyze changes in carbohydrate profiles over developmental time or following environmental perturbations (e.g., drought stress application and relief). This temporal dimension is crucial for understanding dynamic roles of SWEET17 .

  • Comparative analysis across genotypes: Analyze carbohydrate distributions in multiple genetic backgrounds: wild-type, sweet17 knockout mutants, SWEET17 overexpression lines, and complementation lines. This genetic variation approach helps establish causal relationships between SWEET17 activity and observed phenotypes .

  • Spatial visualization techniques: Combine analytical approaches with visualization methods like SWEET17 promoter-GUS fusions or sugar-specific staining to correlate SWEET17 expression patterns with local changes in carbohydrate content .

  • Statistical modeling: Develop mathematical models of sugar transport and distribution based on experimental data to predict how changes in SWEET17 activity would affect whole-plant carbohydrate partitioning under different scenarios.

These integrated approaches provide a comprehensive understanding of how SWEET17 influences carbohydrate distribution at multiple organizational levels, from subcellular compartments to whole-plant physiology.

How should researchers interpret changes in SWEET17 expression across different environmental conditions?

Interpreting changes in SWEET17 expression across environmental conditions requires systematic analysis considering multiple factors:

  • Functional context interpretation: Interpret expression changes in the context of SWEET17's known function as a vacuolar fructose transporter. Upregulation often indicates increased need for fructose mobilization from vacuoles or sequestration into vacuoles, depending on cellular conditions and concentration gradients .

  • Tissue-specific analysis: Analyze expression changes separately for different tissues, as SWEET17 shows tissue-specific expression patterns and responses. For example, strong induction has been observed upon drought stress regardless of the tissue analyzed, but baseline expression levels vary substantially between tissues .

  • Correlation with phenotypic responses: Connect expression changes to measurable phenotypes such as sugar content, growth parameters, or stress tolerance. Research shows that SWEET17 upregulation during drought correlates with maintained branching capacity and reproductive development .

  • Temporal dynamics consideration: Analyze the timing of expression changes relative to the onset of environmental stress or developmental transitions. SWEET17 expression dynamics may vary during immediate stress responses versus long-term adaptation phases.

  • Integration with sugar signaling networks: Interpret SWEET17 expression changes in relation to known sugar signaling pathways and other sugar-responsive genes. This helps establish whether SWEET17 is responding as part of broader metabolic adjustments .

  • Evolutionary conservation analysis: Compare expression patterns of SWEET17 orthologs across species in response to similar environmental conditions. Homologous genes have been shown to be upregulated in multiple species in response to various stresses (salt, osmotic, drought), suggesting conserved functional importance .

  • Regulatory element identification: Analyze the SWEET17 promoter region for stress-responsive elements that might explain observed expression patterns. This can provide mechanistic insight into how environmental signals are translated into SWEET17 expression changes.

  • Expression validation with multiple techniques: Confirm expression changes using complementary methods (RT-qPCR, RNA-seq, promoter-reporter fusions, protein abundance) to ensure robust interpretation. Studies have successfully used both qRT-PCR and promoter-GUS fusions to analyze SWEET17 expression patterns .

This systematic approach to interpreting SWEET17 expression changes helps establish causal relationships between environmental conditions, SWEET17 activity, and physiological responses, advancing our understanding of sugar transport dynamics in plant stress adaptation.

What aspects of SWEET17 function remain poorly understood?

Despite significant advances in understanding SWEET17 function, several aspects remain poorly characterized and represent important areas for future research:

  • Regulatory mechanisms: The molecular mechanisms controlling SWEET17 expression and activity across different conditions and tissues are not fully understood. Identifying transcription factors, post-translational modifications, and other regulatory elements that modulate SWEET17 function would provide valuable insight into sugar transport regulation.

  • Interaction partners: The protein-protein interaction network of SWEET17 remains largely unexplored. Identifying proteins that interact with SWEET17 could reveal novel regulatory mechanisms or functional connections to other cellular processes.

  • Structural dynamics: While basic structural features of SWEET transporters have been described, the specific structural dynamics of SWEET17 during transport cycles and how these relate to its bidirectional transport capability need further characterization .

  • Substrate specificity mechanisms: The molecular basis for SWEET17's high specificity for fructose versus other sugars is not fully understood. Structure-function studies identifying key residues involved in substrate recognition would advance our understanding of sugar transporter evolution.

  • Integration with hormone signaling: The connections between SWEET17 function and plant hormone signaling pathways, particularly under stress conditions, warrant further investigation to understand how sugar transport coordinates with broader stress response networks.

  • Evolutionary history: The evolutionary history of SWEET17 across plant lineages and its functional divergence from other SWEET family members would provide insight into the specialization of sugar transport mechanisms during plant evolution.

  • Metabolic integration: How SWEET17-mediated fructose transport integrates with broader metabolic networks, particularly during carbon starvation or excess, remains to be fully elucidated.

  • Role in other abiotic stresses: While SWEET17's role in drought stress has been characterized, its function in other abiotic stresses (heat, cold, salinity) deserves further investigation to determine if it represents a common stress response mechanism .

  • Crop improvement applications: The potential for modulating SWEET17 expression or activity to improve crop stress resilience or yield stability has been suggested but requires systematic evaluation across different crop species and environmental conditions .

Addressing these knowledge gaps would significantly advance our understanding of plant sugar transport processes and their roles in development and stress responses.

What techniques could advance understanding of SWEET17 structure and function?

Several emerging and established techniques could significantly advance our understanding of SWEET17:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.