Recombinant Arabidopsis thaliana Bidirectional sugar transporter SWEET1 (SWEET1)

Shipped with Ice Packs
In Stock

Description

Substrate Specificity and Transport Mechanism

SWEET1 facilitates the bidirectional transport of glucose and other hexoses via a facilitated diffusion mechanism. Biosensor studies (e.g., SweetTrac1) revealed that SWEET1 recognizes diverse sugars, including glucose, fructose, and acyclic sugars, with varying affinities .

Substrate Recognition

SugarAffinity Relative to GlucoseKey Residues InvolvedReference
GlucoseHighTyr57, Gly58, Pro23
FructoseModerateSer54, Asp185
SucroseLow

Three-State Transport Model
SWEET1 operates through an alternating access mechanism with three states:

  1. Inward-open: Substrate binds from the cytoplasm.

  2. Occluded: Substrate translocation occurs.

  3. Outward-open: Substrate releases to the extracellular space .

Kinetic studies indicate low affinity (millimolar range) and near-symmetric transport (asymmetry ratio ~1.0–1.2), maximizing sugar equilibration at high concentrations .

Functional Role in Plant Physiology

SWEET1 is expressed at the plasma membrane and regulates glucose efflux from cells. Key biological roles include:

  • Sugar Allocation: Maintaining apoplastic glucose levels for cellular energy metabolism .

  • Pathogen Interaction: Modulates susceptibility to root-knot nematodes (Meloidogyne incognita) by altering sugar availability .

  • Stress Response: Upregulated under abiotic stress to balance cellular redox states .

Impact of Loss-of-Function Mutants

MutationPhenotypeReference
atsweet1Reduced root growth, delayed nematode development, altered sugar profiles
Y57A/G58DDominant-negative inhibition of wild-type SWEET1 transport

Biosensors for Sugar Transport Studies

  1. SweetTrac1: Fused with circularly permuted GFP to monitor glucose binding in real time. Identified 12 novel substrates, including diabetes drugs (e.g., 1-deoxynojirimycin) .

  2. SweetTrac2: Targets vacuolar SWEET2 for studying intracellular sugar transport .

Advantages of SWEET-Based Biosensors

FeatureApplicationReference
High SensitivityDetects millimolar glucose concentrations
Substrate ProfilingScreens small-molecule libraries for SWEET substrates
Vacuolar MonitoringTracks sugar sequestration in plant organelles

Evolutionary and Pathological Relevance

SWEET1 homologs are conserved across eukaryotes, with plant-specific expansions enabling diverse sugar transport functions. In humans, SLC50A1 (SWEET1) is linked to lactose concentration in milk and immune cell development . Plant SWEETs like SWEET1 also influence pathogen susceptibility by leaking sugars to invading microbes .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on your purchase method and location. For specific delivery information, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage condition, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
SWEET1; At1g21460; F24J8.9; Bidirectional sugar transporter SWEET1; AtSWEET1; Protein SUGARS WILL EVENTUALLY BE EXPORTED TRANSPORTERS 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SWEET1
Target Protein Sequence
MNIAHTIFGVFGNATALFLFLAPSITFKRIIKNKSTEQFSGIPYPMTLLNCLLSAWYGLP FVSKDNTLVSTINGTGAVIETVYVLIFLFYAPKKEKIKIFGIFSCVLAVFATVALVSLFA LQGNGRKLFCGLAATVFSIIMYASPLSIMRLVVKTKSVEFMPFFLSLFVFLCGTSWFVYG LIGRDPFVAIPNGFGCALGTLQLILYFIYCGNKGEKSADAQKDEKSVEMKDDEKKQNVVN GKQDLQV
Uniprot No.

Target Background

Function
This protein mediates both low-affinity uptake and efflux of sugar across the plasma membrane. It can transport glucose and, to a lesser extent, mannose, fructose, and galactose.
Database Links

KEGG: ath:AT1G21460

STRING: 3702.AT1G21460.1

UniGene: At.41655

Protein Families
SWEET sugar transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane.
Tissue Specificity
Mainly expressed in flowers.

Q&A

What is Arabidopsis thaliana SWEET1 and how does it function?

SWEET1 (AtSWEET1) belongs to the SWEET (Sugars Will Eventually be Exported Transporters) family, a new class of sugar uniporters discovered in plants. It functions as a bidirectional facilitator that transports sugars across cell membranes along concentration gradients. Unlike other sugar transporters, SWEET1 doesn't rely on proton gradients or energy to complete sugar translocation - it simply uses the concentration gradient of intracellular and extracellular sugars to transport them across membranes . This means SWEET1 can transport sugars in both directions (import or export) depending solely on the sugar concentration differential, without dependence on environmental pH .

How does SWEET1 differ structurally and functionally from other sugar transporters?

CharacteristicSWEET1SUTs/MSTs
Energy requirementNo energy needed (passive transport)Requires energy (active transport)
Transport mechanismUniporter/facilitatorProton-coupled symporters
DirectionalityBidirectional along concentration gradientUnidirectional
pH dependencypH-independentpH-dependent
SizeRelatively small (27 kDa)Larger
Structure7 transmembrane domainsVaries (usually larger)

SWEET1 transports sugars passively without coupling to H+ ions, unlike SUTs (sucrose transporters) and MSTs (monosaccharide transporters) which use proton gradients for active transport . The structural simplicity of SWEETs makes them excellent molecular models for studying sugar recognition mechanisms .

What substrates can SWEET1 transport, and how were they identified?

SWEET1 has demonstrated the ability to transport:

  • D-glucose

  • D-fructose

  • D-mannose

  • 1-deoxynojirimycin (diabetes drug)

  • Voglibose (diabetes drug)

  • 1-thio-D-glucose

These substrates were identified using SweetTrac1, a biosensor created by fusing a conformation-sensitive fluorescent protein to SWEET1. This biosensor translates substrate binding into fluorescence changes, enabling high-throughput screening of potential substrates . Through screening and subsequent cheminformatics analysis of 182 natural and synthetic carbohydrates, researchers identified 15 chemicals capable of binding to SWEET1's substrate pocket, revealing that the transporter can recognize various furanoses, pyranoses, and acyclic sugars .

What methodology can be employed to study SWEET1 substrate specificity?

Studying SWEET1 substrate specificity requires a multi-faceted approach:

  • Biosensor screening: The SweetTrac1 biosensor system provides real-time detection of substrate binding through fluorescence changes, allowing high-throughput screening of potential substrates .

  • Radiolabeled uptake assays: Confirming transport activity using radiolabeled versions of potential substrates to directly measure cellular uptake in systems expressing SWEET1 .

  • Cheminformatics analysis: Computational approaches to identify structural features common among SWEET1 substrates, which can predict new potential substrates .

  • Heterologous expression systems: Expression of SWEET1 in yeast or other systems to assess transport capabilities through growth assays or direct measurements .

  • Mutagenesis studies: Systematic mutation of residues in the binding pocket to determine their contribution to substrate specificity .

This combined approach has successfully identified both known hexoses and novel substrates, including pharmaceutical compounds .

How do SWEET1 and SWEET2 compare in terms of substrate recognition?

Despite their different subcellular localizations (SWEET1 in plasma membrane, SWEET2 in vacuolar membrane), these transporters share remarkable similarities in substrate recognition:

CharacteristicSWEET1SWEET2
LocalizationPlasma membraneVacuolar membrane
Substrate overlapRecognizes at least 14 shared substratesCan recognize 14 chemicals transported by SWEET1
Substrate affinityDifferent affinities for some substratesDifferent affinities for some substrates
Binding mechanismNon-specific interactions with key residuesNon-specific interactions with key residues

Research using SweetTrac1 (based on SWEET1) and SweetTrac2 (based on SWEET2) biosensors revealed that both transporters recognize similar substrates but with different affinities . These differences in affinity depend on non-specific interactions involving key residues in the substrate-binding pocket, as confirmed through sequence comparison and mutagenesis analysis . This comparative approach has provided valuable insights into the molecular basis of substrate recognition in the SWEET family.

What structural features determine SWEET1 substrate specificity?

While complete structural details specific to SWEET1 binding mechanisms aren't fully characterized, several key structural elements determine substrate specificity:

  • SWEET1, like most eukaryotic SWEETs, has seven transmembrane (TM) domains arranged as two triplet helix bundles (THB1 and THB2) connected by TM4 .

  • This arrangement creates a substrate translocation pathway through the membrane.

  • In related SWEET transporters, key binding residues include cysteine residues from TM2, asparagine residues from TM3 and TM7, and phenylalanine residues from TM6 .

  • Mutagenesis studies have characterized approximately 13% of SWEET1's amino acids (27 kDa protein), revealing their contributions to substrate binding and transport .

  • The binding pocket appears to accommodate various sugar structures, including different furanoses, pyranoses, and acyclic sugars, suggesting flexible substrate recognition rather than highly specific binding .

This structural flexibility explains SWEET1's ability to transport diverse substrates while maintaining selectivity for sugar-like molecules.

What expression systems are optimal for producing recombinant SWEET1?

Recombinant Arabidopsis thaliana SWEET1 can be expressed in multiple host systems, each with specific advantages:

Expression SystemAdvantagesTypical Purity
E. coliHigh yield, simple, economical≥85% by SDS-PAGE
YeastEukaryotic processing, membrane insertion≥85% by SDS-PAGE
BaculovirusHigher eukaryotic system, better folding≥85% by SDS-PAGE
Mammalian cellsNative-like post-translational modifications≥85% by SDS-PAGE

The choice depends on research requirements. For functional studies, yeast systems offer advantages as they provide a eukaryotic environment while allowing transport studies. For structural studies requiring high protein yields, E. coli or baculovirus systems might be preferable . The recombinant protein typically contains the key domains necessary for function, including the MtN3 (Nodulin) family domain characteristic of SWEET transporters .

How can SweetTrac biosensors be designed and utilized for SWEET transport studies?

SweetTrac biosensors represent a breakthrough methodology for studying SWEET transporters:

  • Design principle: SweetTrac1 was created by intramolecular fusion of a conformation-sensitive fluorescent protein to SWEET1, producing a sensor that translates substrate binding into detectable fluorescence changes .

  • Applications:

    • High-throughput screening of potential substrates

    • Measurement of binding affinities

    • Real-time monitoring of transport activity

    • Structure-function analysis when combined with mutagenesis

  • Methodology implementation:

    • Express the biosensor in appropriate cells (typically yeast)

    • Expose to potential substrates in a plate reader format

    • Monitor fluorescence changes that indicate substrate binding

    • Confirm actual transport using complementary methods (radioactive uptake assays)

This approach was expanded with SweetTrac2 (based on SWEET2), enabling comparative studies of substrate specificity between different SWEET family members and providing a tool for monitoring sugar transport at vacuolar membranes .

What techniques are available for studying SWEET1 structure-function relationships?

Several complementary techniques are essential for comprehensive structure-function analysis:

  • Site-directed mutagenesis: Systematic mutation of specific residues allows identification of amino acids critical for substrate binding and transport. Approximately 13% of SWEET1's amino acids have been characterized through this approach .

  • Biosensor-based assays: Using SweetTrac1 to measure how mutations affect substrate binding and recognition provides rapid functional assessment .

  • Heterologous expression: Expression of wild-type and mutant versions in systems like yeast allows functional characterization through transport assays .

  • Comparative analysis: Sequence comparison between SWEET1 and other family members (like SWEET2) can identify conserved functional regions and unique determinants of specificity .

  • Small molecule screening: Testing diverse chemical libraries using biosensors can reveal structural requirements for substrate recognition .

These approaches have successfully identified both the substrates and key structural elements of SWEET1, advancing our understanding of this important transporter family.

What analytical challenges exist in detecting and quantifying SWEET1 activity in planta?

Studying SWEET1 in its native context presents several challenges:

  • Low abundance: SWEET transporters are often expressed at relatively low levels, making detection difficult using standard techniques.

  • Functional redundancy: The presence of multiple SWEET family members (approximately 20 in most plant genomes) with overlapping substrate specificities complicates the assessment of SWEET1-specific functions .

  • Technical limitations: Traditional methods for measuring sugar transport (like radioactive uptake) are difficult to apply in intact plant tissues.

  • Subcellular localization: Distinguishing plasma membrane transport from other cellular compartments requires specialized approaches.

The development of SweetTrac biosensors represents a significant advance in addressing these challenges, potentially allowing monitoring of SWEET1 activity in more native contexts . Future research may focus on developing plant-compatible versions of these biosensors for in vivo studies.

What are promising research avenues for SWEET1 engineering and biotechnology applications?

Several promising research directions emerge from our current understanding of SWEET1:

  • Crop improvement: Engineering SWEET1 expression or activity could potentially enhance sugar allocation in crops, improving yield or stress tolerance .

  • Biosensor development: Further refinement of SweetTrac biosensors could enable in vivo sugar monitoring in plants or development of diagnostic tools .

  • Drug delivery systems: The ability of SWEET1 to transport diabetes drugs like 1-deoxynojirimycin and voglibose suggests potential applications in pharmaceutical delivery systems .

  • Structural biology: Complete structural characterization of SWEET1 could facilitate rational design of inhibitors or activators with agricultural applications.

  • Synthetic biology: Integration of SWEET1 into engineered metabolic pathways could facilitate sugar export from cells in bioproduction systems.

These applications highlight the significance of foundational research on SWEET1 structure and function for both basic science and practical biotechnological innovations.

How might comparative analysis of SWEET family members inform SWEET1 research?

Comparative analysis across the SWEET family provides valuable insights:

SWEET Family MemberLocationPrimary SubstratesComparison Value
SWEET1 (Clade I)Plasma membraneHexosesReference transporter
SWEET2 (Clade I)Vacuolar membraneSimilar substrates to SWEET1Reveals membrane-specific adaptations
SWEET11/12 (Clade III)Phloem parenchymaPrimarily sucroseHighlights clade-specific substrate preferences

The comparison between SWEET1 and SWEET2 has already revealed that similar substrate recognition mechanisms operate across different cellular membranes, with specific residues modulating affinity rather than selectivity . Further comparative studies across all four clades could:

  • Identify universal vs. clade-specific substrate recognition mechanisms

  • Reveal evolutionary adaptations for different physiological roles

  • Provide insights into membrane-specific functional requirements

  • Guide rational engineering of SWEET transporters for specific applications

This comparative approach represents one of the most promising strategies for advancing our understanding of SWEET1 structure-function relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.