Recombinant Arabidopsis thaliana Bidirectional sugar transporter SWEET2 (SWEET2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock. However, if you have any specific requirements for the format, please remark your requirement when placing the order. We will prepare the product according to your demand.
Lead Time
Delivery time may differ depending on the purchasing method or location. Please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are shipped with normal blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of the product is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specified tag type requirement, please inform us, and we will prioritize developing the product with the specified tag.
Synonyms
SWEET2; At3g14770; T21E2.2; Bidirectional sugar transporter SWEET2; AtSWEET2; Protein SUGARS WILL EVENTUALLY BE EXPORTED TRANSPORTERS 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-236
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SWEET2
Target Protein Sequence
MDVFAFNASLSMCKDVAGIAGNIFAFGLFVSPMPTFRRIMRNKSTEQFSGLPYIYALLNC LICLWYGTPFISHSNAMLMTVNSVGATFQLCYIILFIMHTDKKNKMKMLGLLFVVFAVVG VIVAGSLQIPDQLTRWYFVGFLSCGSLVSMFASPLFVINLVIRTKSVEFMPFYLSLSTFL MSASFLLYGLFNSDAFVYTPNGIGTILGIVQLALYCYYHRNSIEEETKEPLIVSYV
Uniprot No.

Target Background

Function
SWEET2 mediates both low-affinity uptake and efflux of sugar across the plasma membrane.
Gene References Into Functions
  1. SWEET2 expression is induced by Pythium infection in roots. Root-expressed vacuolar SWEET2 modulates sugar secretion, possibly by reducing the availability of glucose sequestered in the vacuole, thereby limiting carbon loss to the rhizosphere. PMID: 26234706
Database Links

KEGG: ath:AT3G14770

STRING: 3702.AT3G14770.1

UniGene: At.26391

Protein Families
SWEET sugar transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is SWEET2 and what is its primary function in Arabidopsis?

SWEET2 is a member of the Sugars Will Eventually be Exported Transporters (SWEET) family, which is central for sugar allocation in plants. SWEET2 specifically functions as a vacuolar sugar transporter in Arabidopsis thaliana, primarily transporting hexoses across the tonoplast membrane . Unlike plasma membrane-localized SWEET transporters, SWEET2 modulates sugar storage and sequestration in the vacuole, which appears to limit carbon loss to the rhizosphere by reducing the availability of glucose that could be secreted from roots . This function is particularly important in root tissue, where SWEET2 helps regulate the balance between sugar storage and secretion.

Where is SWEET2 primarily expressed in Arabidopsis thaliana?

SWEET2 is highly expressed in Arabidopsis roots, with expression patterns confirmed using SWEET2–β-glucuronidase fusions. Studies have shown that SWEET2 accumulates predominantly in root cells, specifically in the epidermal cells of the root apex . This localized expression pattern aligns with its proposed function in modulating sugar secretion from roots into the rhizosphere. The specific expression in root epidermal cells suggests SWEET2 plays a targeted role in controlling sugar movement at the root-soil interface.

How does SWEET2 differ structurally from other SWEET family transporters?

SWEET2 belongs to clade I of the SWEET family, which typically prefers hexoses as substrates . While SWEET2 shares approximately 44% sequence identity with SWEET1 (another clade I member), it differs in its subcellular localization and specific binding affinities . Both transporters recognize similar substrates but with different affinities. The substrate binding pocket of SWEET2 contains unique hydrophobic residues that influence its substrate specificity and transport characteristics. These structural differences help explain the specialized functions of different SWEET transporters within the plant.

What substrates does SWEET2 transport and with what affinities?

SWEET2 primarily transports hexose sugars, with D-glucose being its preferred substrate. Functional analysis using the SweetTrac2 biosensor has revealed the following substrate affinities (measured as equilibrium exchange constants, KR0/R):

SubstrateSWEET2 Affinity (KR0/R)SWEET1 Affinity (KR0/R)
D-glucose3 ± 1 mM22 ± 6 mM
D-mannose39 ± 15 mM11 ± 3 mM
D-fructose122 ± 38 mM150 ± 39 mM

SWEET2 shows the highest affinity for D-glucose (with a KR0/R value of approximately 3 mM), suggesting it is the preferred physiological substrate . The transporter also recognizes other sugars but with lower affinities, such as D-mannose and D-fructose. Interestingly, some modified sugars that are recognized by SWEET1 are not transported by SWEET2, indicating subtle differences in substrate recognition mechanisms between these related transporters .

What are the key methodologies for studying SWEET2 function in planta?

To study SWEET2 function in plants, several complementary approaches can be employed:

  • Genetic approaches: Generate and characterize loss-of-function sweet2 mutants and overexpression lines. Phenotypic analysis should focus on sugar content in tissues, carbon efflux from roots, and responses to excess glucose and pathogen challenges.

  • Localization studies: Create fluorescent protein fusions (SWEET2-GFP) to confirm tonoplast localization using confocal microscopy.

  • Expression analysis: Use promoter-reporter fusions (SWEET2-β-glucuronidase) to analyze tissue-specific expression patterns and expression changes in response to environmental stimuli or pathogen infection.

  • Transport assays: Measure glucose uptake into isolated vacuoles or use radioactively labeled sugars to track transport in wild-type versus sweet2 mutant plants.

  • Carbon efflux measurements: Quantify glucose-derived carbon efflux from roots using isotope labeling techniques (13C or 14C) to assess how SWEET2 affects rhizodeposition.

  • Pathogen susceptibility assays: Challenge plants with Pythium or other root pathogens and assess disease progression and plant growth after infection.

These methodologies can be combined to provide comprehensive insights into SWEET2's role in plant sugar homeostasis and defense responses .

What is SweetTrac2 and how can it be implemented in sugar transport research?

SweetTrac2 is a novel biosensor developed based on the Arabidopsis vacuole membrane transporter SWEET2 . This biosensor was generated by the intramolecular fusion of a conformation-sensitive fluorescent protein (circularly permutated, superfolded GFP) into SWEET2, similar to the previously developed SweetTrac1 for SWEET1 .

Implementation methodology:

  • Construction: Transfer the circularly permutated, superfolded GFP and linkers into the same position in AtSWEET2 as used for SweetTrac1.

  • Expression system: Express SweetTrac2 in yeast cells, where it localizes to the vacuole, mirroring its natural localization in plants.

  • Fluorescence measurement: Use spectral analysis to monitor changes in fluorescence intensity upon sugar addition. SweetTrac2 shows two excitation maxima—a major peak at ~490 nm and a minor peak at ~410 nm—with a single emission maximum at ~515 nm .

  • Substrate testing: Introduce various sugars and measure fluorescence changes to determine binding specificity and affinity.

  • Affinity quantification: Calculate the equilibrium exchange constant (KR0/R) as the concentration of substrate that saturates half of the biosensor at steady state.

SweetTrac2 is particularly valuable for monitoring sugar transport at vacuolar membranes, which are otherwise challenging to study directly . It provides a real-time, non-invasive method to investigate sugar flux across the tonoplast and substrate specificity of vacuolar transporters.

How does SWEET2 contribute to plant defense against pathogens?

SWEET2 plays a significant role in plant defense, particularly against the root pathogen Pythium. The defense contribution occurs through several mechanisms:

  • Expression upregulation: SWEET2 root expression is induced more than 10-fold during Pythium infection, suggesting a direct response to pathogen presence .

  • Sugar availability limitation: By sequestering sugars in the vacuole, SWEET2 reduces the availability of sugars in the rhizosphere that could otherwise be utilized by pathogens as a carbon source .

  • Reduced susceptibility: Loss-of-function sweet2 mutants show increased susceptibility to Pythium infection, exhibiting impaired growth after infection compared to wild-type plants .

  • Carbon allocation control: SWEET2 limits carbon sequestration from roots, potentially altering the nutritional environment at the root-soil interface in a way that is less favorable for pathogen proliferation .

The evidence suggests that SWEET2-mediated control of sugar transport across the tonoplast represents an important component of the plant's defensive strategy against soil-borne pathogens. This highlights how specialized transport proteins can contribute to both metabolic regulation and pathogen resistance through the same biochemical activity .

What molecular mechanisms underlie substrate recognition in SWEET2?

Substrate recognition in SWEET2 involves a combination of specific and non-specific interactions:

  • Specific interactions: Hydrogen bonds form between key hydroxyl groups in the sugar substrates and conserved residues in the transporter. Similar to SWEET1, residues equivalent to N73 and N192 in SWEET1 are likely crucial for these specific interactions .

  • Non-specific interactions: Hydrophobic residues determine the size and tortuosity of the binding pocket, influencing substrate affinity. Based on molecular docking simulations with the rice SWEET2b structure and various sugars, three hydrophobic residues in the binding pocket (V73, V76, and I193 in rice SWEET2b, corresponding to different residues in AtSWEET2) are likely directly involved in substrate interactions .

  • Binding pocket architecture: The differences in affinity between SWEET1 and SWEET2 for the same substrates are attributed to these non-specific interactions and the architecture of the binding pocket .

  • Conformational changes: Upon substrate binding, SWEET transporters undergo conformational changes that can be detected by the SweetTrac biosensors, indicating a substrate-induced structural rearrangement that facilitates transport .

Mutagenesis studies targeting these key residues have confirmed their importance in substrate recognition and transport activity, providing insight into the molecular basis of SWEET transporter substrate specificity .

What phenotypes are observed in sweet2 mutant plants?

Loss-of-function sweet2 mutants display several distinct phenotypes that provide insights into SWEET2's physiological roles:

  • Reduced glucose tolerance: Mutants show decreased tolerance to excess glucose, indicating altered sugar homeostasis .

  • Altered sugar content: sweet2 plants exhibit lower glucose accumulation in leaves compared to wild-type plants, suggesting systemic effects on sugar distribution .

  • Increased carbon efflux: Mutants show 15-25% higher glucose-derived carbon efflux from roots, supporting SWEET2's role in preventing sugar loss from root tissue to the rhizosphere .

  • Enhanced pathogen susceptibility: sweet2 mutants are more susceptible to Pythium infection, showing impaired growth after infection compared to wild-type plants .

  • Vacuolar sugar storage: Without functional SWEET2, the ability to sequester glucose in the vacuole is compromised, potentially affecting osmotic regulation in root cells.

These phenotypes collectively support the model that SWEET2 functions to modulate sugar secretion by facilitating glucose transport across the tonoplast, thereby limiting carbon loss to the rhizosphere and contributing to defense against soil-borne pathogens .

How do SWEET1 and SWEET2 differ in their substrate recognition and transport properties?

Despite sharing 44% sequence identity and both belonging to clade I of the SWEET family, SWEET1 and SWEET2 exhibit significant differences in their transport properties:

PropertySWEET1SWEET2
Cellular localizationPlasma membraneTonoplast (vacuolar membrane)
Primary functionSugar export/import across plasma membraneSugar sequestration in vacuole
Preferred substrateD-glucose, D-mannoseD-glucose
D-glucose affinity (KR0/R)22 ± 6 mM3 ± 1 mM
D-mannose affinity (KR0/R)11 ± 3 mM39 ± 15 mM
D-fructose affinity (KR0/R)150 ± 39 mM122 ± 38 mM
Expression patternMultiple tissuesPredominantly in roots

The key differences in substrate affinity are attributed to non-specific interactions involving hydrophobic residues in the substrate-binding pocket. While SWEET1 has higher affinity for D-mannose, SWEET2 shows significantly higher affinity for D-glucose . These differences in substrate preference and localization highlight how these transporters have evolved specialized functions in different cellular compartments, with SWEET2 optimized for vacuolar glucose transport in root cells .

What considerations should be made when interpreting data from SweetTrac biosensors?

When using SweetTrac biosensors for research, several important considerations should be addressed:

  • Metabolic interference: For metabolizable sugars like D-glucose, D-fructose, and D-mannose, cellular catabolism can produce variability in fluorescence measurements. Researchers should consider using higher expression levels of transporters to offset consumption by glycolysis .

  • Alternative transporters: Some sugars might be transported by endogenous transporters even in supposedly transporter-deficient yeast strains. For example, D-turanose can be taken up by EBY4000 cells despite lacking all known hexose transporters .

  • Metabolic conversion: Some substrates may be broken down enzymatically inside cells. D-turanose, for instance, is broken down by α-glucosidase in yeast cells into D-glucose and D-fructose, potentially complicating interpretation of fluorescence signals .

  • Competitive inhibition: Some molecules may produce no fluorescence response not because they aren't recognized but because they may be competitive inhibitors rather than transported substrates .

  • Localization effects: The subcellular localization of biosensors affects their ability to detect different pools of sugars. SweetTrac1 (plasma membrane) responds to extracellular sugars, while SweetTrac2 (vacuole) only responds to intracellular sugars .

  • Expression system differences: Protein expression levels can vary between genome-integrated and plasmid-based systems, affecting transport rates and consequently biosensor responses .

Careful controls and complementary approaches are necessary to accurately interpret data from these biosensors and distinguish between direct substrate transport and indirect effects .

How can mutagenesis approaches be used to study substrate specificity in SWEET2?

Mutagenesis approaches provide powerful tools for investigating substrate specificity in SWEET2:

  • Target selection strategy:

    • Identify conserved residues between SWEET1 and SWEET2 for potential specific interactions

    • Focus on non-conserved residues that may explain differences in affinity

    • Use molecular docking simulations with available crystal structures (e.g., rice SWEET2b) to identify residues likely involved in substrate binding

  • Key residues for mutagenesis:

    • Polar residues that form hydrogen bonds with substrate hydroxyl groups

    • Hydrophobic residues that determine binding pocket size and shape

    • Residues that differ between SWEET1 and SWEET2 in equivalent positions

  • Mutation types to consider:

    • Conservative substitutions to subtly alter binding properties

    • Radical substitutions to drastically change the chemical environment

    • Swapping residues between SWEET1 and SWEET2 to test if specificity characteristics transfer

  • Functional analysis methods:

    • Express mutant versions in SweetTrac2 biosensor system to directly measure changes in substrate affinity

    • Conduct complementation assays in sweet2 mutant plants to assess functional recovery

    • Perform in vitro transport assays with reconstituted proteins

  • Data interpretation framework:

    • Compare KR0/R values for different substrates across mutant variants

    • Assess changes in substrate preference hierarchy

    • Correlate structural changes with functional outcomes using molecular modeling

This systematic mutagenesis approach has already revealed that substrate recognition by SWEETs relies on both specific interactions (hydrogen bonds) and non-specific interactions (hydrophobic pocket architecture), with the latter explaining the subtle differences in affinities between SWEET1 and SWEET2 .

What are the optimal expression systems for recombinant SWEET2 production?

When designing experiments for recombinant SWEET2 production, researchers should consider several expression systems, each with specific advantages:

  • Yeast expression systems:

    • Saccharomyces cerevisiae: Particularly useful for functional studies as demonstrated with SweetTrac2 biosensor. The hexose-transporter-deficient strain EBY4000 provides a clean background for sugar transport studies .

    • Advantages: Eukaryotic processing, tonoplast targeting similar to plants, relatively high protein yields

    • Methodology: Use either genome integration for stable expression or plasmid-based systems for higher expression levels

  • Plant expression systems:

    • Arabidopsis thaliana: Ideal for complementation studies in sweet2 mutant backgrounds

    • Nicotiana benthamiana: Useful for transient expression and rapid localization studies

    • Advantages: Native cellular environment, proper post-translational modifications, authentic subcellular targeting

  • Insect cell expression:

    • Advantages: Higher protein yields than yeast, maintains eukaryotic processing

    • Particularly useful for structural studies requiring larger protein quantities

  • Bacterial expression:

    • E. coli systems can be used for producing protein domains for antibody generation or structural studies

    • Generally challenging for full-length membrane proteins but may work for soluble domains

  • Cell-free expression systems:

    • Emerging option for difficult-to-express membrane proteins

    • Allows direct incorporation into liposomes for functional studies

For functional studies, the yeast system has proven particularly effective for SWEET2, especially when using the SweetTrac2 biosensor approach . The choice of expression system should align with specific experimental goals, whether focused on structural characterization, transport assays, or in planta function.

How can isotope labeling be effectively used to study SWEET2-mediated sugar transport?

Isotope labeling provides powerful approaches for quantifying SWEET2-mediated sugar transport in various experimental systems:

  • 13C/14C-glucose pulse-chase experiments:

    • Methodology: Feed plants with 13C or 14C-labeled glucose, then track the isotope's movement through different tissues and into the rhizosphere

    • Analysis: Compare isotope distribution between wild-type and sweet2 mutant plants

    • Expected outcomes: sweet2 mutants show 15-25% higher labeled carbon efflux from roots

    • Controls: Include plants with mutations in other sugar transporters to distinguish SWEET2-specific effects

  • Compartment-specific analysis:

    • Methodology: Isolate vacuoles from labeled plants and measure isotope accumulation

    • Application: Directly quantify SWEET2's contribution to vacuolar sugar sequestration

    • Technical approach: Combine with non-aqueous fractionation techniques to preserve in vivo metabolite distribution

  • Dual-isotope approaches:

    • Methodology: Simultaneously track different sugar types using distinct isotopes (e.g., 13C-glucose and 14C-fructose)

    • Application: Determine substrate preferences in vivo

    • Analysis: Calculate relative transport rates for different sugars

  • Time-course experiments:

    • Methodology: Sample at multiple timepoints after isotope administration

    • Application: Determine transport kinetics and sugar flux rates

    • Analysis: Develop mathematical models of sugar movement between compartments

  • Combining with imaging techniques:

    • Methodology: Use positron emission tomography (PET) with 11C-labeled sugars

    • Application: Non-invasive visualization of sugar movement in intact plants

    • Advantage: Provides spatial and temporal resolution of transport processes

These isotope-based approaches provide quantitative data on SWEET2-mediated sugar transport and have already revealed that loss of SWEET2 function results in significantly higher glucose-derived carbon efflux from roots, supporting its role in preventing sugar loss to the rhizosphere .

How might SWEET2 be utilized in enhancing plant resistance to root pathogens?

Based on the finding that SWEET2 contributes to resistance against Pythium infection, several research applications can be explored:

  • Genetic engineering approaches:

    • Overexpression of SWEET2 specifically in root tissues to enhance pathogen resistance

    • Development of pathogen-inducible SWEET2 expression systems that activate more strongly upon infection

    • Creation of SWEET2 variants with enhanced transport activity through protein engineering

  • Breeding strategies:

    • Screen germplasm collections for natural SWEET2 variants with enhanced activity

    • Develop molecular markers for SWEET2 alleles associated with increased pathogen resistance

    • Incorporate optimal SWEET2 alleles into elite breeding lines

  • Agricultural management implications:

    • Soil management practices that optimize SWEET2 expression and function

    • Identification of environmental factors that influence SWEET2 activity

    • Development of priming treatments that increase SWEET2 expression before pathogen exposure

  • Research applications for other pathosystems:

    • Investigate SWEET2's role in resistance to other soil-borne pathogens beyond Pythium

    • Explore potential interactions between SWEET2 and beneficial microorganisms

    • Study whether SWEET2 affects mycorrhizal associations that involve sugar exchange

  • Mechanistic investigations:

    • Determine how precisely SWEET2-mediated sugar compartmentalization affects pathogen metabolism

    • Identify potential synergies between SWEET2 and other defense mechanisms

    • Develop biosensors to monitor rhizosphere sugar levels in relation to SWEET2 activity and pathogen growth

The evidence that sweet2 mutants show increased susceptibility to Pythium and that SWEET2 expression is strongly induced during infection suggests significant potential for leveraging this transporter in breeding programs focused on root disease resistance .

What are the current technical challenges in studying vacuolar sugar transport?

Studying vacuolar sugar transport presents several technical challenges that researchers must address:

  • Isolation difficulties:

    • Obtaining intact, functional vacuoles from plant tissues is technically challenging

    • Vacuoles are fragile and susceptible to rupture during isolation procedures

    • Current methods often result in low yields and potential loss of transport activity

  • Measurement limitations:

    • Direct measurement of sugar transport across the tonoplast in real-time is difficult

    • Traditional radiotracer methods require disruption of cellular integrity

    • Distinguishing between different transport pathways (channels, transporters, vesicular trafficking) is challenging

  • Compartmentation issues:

    • Sugars undergo rapid metabolism and interconversion between compartments

    • Cytosolic contamination can confound vacuolar measurements

    • Distinguishing between membrane-bound and luminal pools of sugars is difficult

  • Technological solutions:

    • Biosensors like SweetTrac2 offer new approaches for monitoring vacuolar sugar transport

    • FRET-based sensors can provide real-time monitoring of sugar levels

    • Single-cell approaches may overcome limitations of tissue heterogeneity

  • Integration challenges:

    • Connecting molecular-level transport measurements to whole-plant phenotypes

    • Accounting for developmental and environmental variability

    • Disambiguating the specific contributions of individual transporters in a complex system

The development of SweetTrac2 represents a significant advance in addressing these challenges, offering a tool for monitoring sugar transport at vacuolar membranes that would otherwise be challenging to study directly . Further technological innovations will continue to improve our ability to study vacuolar sugar transport with greater precision and physiological relevance.

How does SWEET2 function integrate with broader plant carbon partitioning networks?

SWEET2's role extends beyond localized sugar transport to influence whole-plant carbon partitioning networks:

  • Root-shoot sugar balance:

    • By limiting sugar efflux from roots, SWEET2 potentially increases carbon availability for transport to shoots

    • sweet2 mutants show lower glucose accumulation in leaves, suggesting systemic effects on sugar distribution

    • SWEET2 activity may influence source-sink relationships throughout the plant

  • Integration with other transporters:

    • SWEET2 functions alongside other tonoplast transporters (e.g., TMTs, VGTs) in controlling vacuolar sugar content

    • Coordination with plasma membrane transporters (including SWEET1) determines net cellular sugar fluxes

    • Functional relationships with sucrose transporters influence the balance between different sugar forms

  • Metabolic network connections:

    • Vacuolar sugar sequestration affects cytosolic sugar concentrations, influencing metabolic enzyme activities

    • Sugar signaling pathways respond to changes in sugar compartmentation

    • SWEET2 activity may indirectly affect starch metabolism and other carbon storage pathways

  • Environmental response integration:

    • SWEET2 expression is highly induced during pathogen infection (>10-fold increase)

    • Carbon partitioning priorities shift during stress responses

    • SWEET2 may participate in stress-induced metabolic reprogramming

  • Developmental context:

    • SWEET2's predominant expression in root epidermal cells suggests specialized roles in root development

    • Root architecture development depends on proper sugar distribution

    • Root-specific carbon allocation patterns change throughout plant development

Understanding these integration points is essential for developing a comprehensive model of how SWEET2 contributes to whole-plant carbon economy and stress responses. Future research should focus on these system-level interactions to fully appreciate SWEET2's physiological significance .

What are the most promising research directions for SWEET2 investigation?

Based on current understanding of SWEET2 function, several promising research directions emerge:

  • Structural biology approaches:

    • Determine the high-resolution structure of Arabidopsis SWEET2 in different conformational states

    • Conduct comparative structural analysis with other SWEET family members

    • Use structural insights to engineer SWEET2 variants with altered substrate specificity or transport rates

  • Systems biology integration:

    • Map the complete sugar transport network in Arabidopsis roots

    • Develop predictive models of carbon flux with and without functional SWEET2

    • Identify key regulatory nodes that control SWEET2 expression and activity

  • Plant-microbe interaction studies:

    • Expand pathogen response studies beyond Pythium to other soil-borne pathogens

    • Investigate how SWEET2 affects beneficial microbial communities in the rhizosphere

    • Explore potential manipulation of SWEET2 by pathogens or symbionts

  • Translational applications:

    • Engineer crops with optimized SWEET2 expression for enhanced pathogen resistance

    • Develop SWEET2-based strategies for controlling root exudation in agricultural settings

    • Screen for chemical compounds that modulate SWEET2 activity as potential agrochemicals

  • Advanced biosensor development:

    • Create improved versions of SweetTrac2 with higher sensitivity or different spectral properties

    • Develop in planta biosensors for monitoring SWEET2 activity in living plants

    • Adapt the SweetTrac approach to other challenging membrane transporters

These research directions promise to expand our understanding of SWEET2's role in plant biology and potentially lead to applications in agriculture and biotechnology. The combination of structural, functional, and systems approaches will provide a comprehensive picture of this important transporter .

What hypotheses remain untested regarding SWEET2 function in plants?

Despite significant advances in understanding SWEET2, several important hypotheses remain untested:

  • Regulatory mechanisms hypothesis: SWEET2 activity may be regulated post-translationally through phosphorylation or other modifications in response to environmental cues or sugar availability.

    • Test using: Phosphoproteomics, site-directed mutagenesis of potential regulatory sites, in vitro assays with purified proteins

  • Stress response coordination hypothesis: SWEET2 may coordinate with stress-responsive signaling pathways beyond pathogen defense, such as drought or nutrient deficiency responses.

    • Test using: Transcriptomics of sweet2 mutants under various stresses, phenotypic analysis in combined stress conditions

  • Developmental programming hypothesis: SWEET2 expression patterns may change throughout plant development, with corresponding changes in root sugar exudation profiles.

    • Test using: Stage-specific expression analysis, sugar secretion measurements across developmental stages

  • Substrate range hypothesis: SWEET2 may transport additional substrates beyond hexose sugars, potentially including signaling molecules or metabolic intermediates.

    • Test using: Comprehensive substrate screening with SweetTrac2, metabolomics of sweet2 mutants

  • Tonoplast integrity hypothesis: Beyond direct transport functions, SWEET2 may contribute to tonoplast integrity or vesicular trafficking processes.

    • Test using: Detailed ultrastructural analysis, vesicle tracking in sweet2 mutants

  • Hormonal crosstalk hypothesis: SWEET2 expression and activity may be modulated by plant hormones, creating integration points between sugar and hormone signaling networks.

    • Test using: Hormone treatments, analysis in hormone signaling mutants, promoter analysis

  • Evolutionary adaptation hypothesis: SWEET2 function may have evolved differently across plant species adapted to different soil environments and pathogen pressures.

    • Test using: Comparative functional analysis across diverse plant species, correlation with ecological parameters

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.