Recombinant Arabidopsis thaliana Bidirectional sugar transporter SWEET4 (SWEET4)

Shipped with Ice Packs
In Stock

Description

Table 1: Functional Characterization of SWEET4

PropertyDetailsSources
SubstratesGlucose, fructose
Transport MechanismBidirectional, energy-independent facilitated diffusion
Expression SitesStele of roots, leaf veins, floral vasculature
LocalizationPlasma membrane
OligomerizationLikely forms functional homooligomers or heterooligomers for transport activity
  • Yeast Complementation Assays: SWEET4 restores growth in glucose/fructose-deficient yeast strains, confirming its role in hexose transport .

  • Bidirectional Transport: Unlike proton-coupled symporters, SWEET4 equilibrates intracellular and extracellular sugar concentrations .

Physiological Roles in Arabidopsis

SWEET4 regulates sugar allocation in axial tissues, impacting plant growth and stress adaptation:

Key Findings:

  1. Growth Modulation:

    • Overexpression increases plant size and glucose/fructose accumulation .

    • RNAi knockdown reduces biomass, sugar content, and causes leaf chlorosis .

  2. Stress Responses:

    • Overexpression enhances freezing tolerance, likely via increased soluble sugar levels .

    • Promotes susceptibility to Pseudomonas syringae by elevating apoplastic sugar availability .

Recombinant SWEET4 Studies

Recombinant SWEET4 has been expressed in heterologous systems to dissect its transport properties:

Table 2: Recombinant SWEET4 Applications

SystemFindingsSources
YeastComplements glucose/fructose uptake defects; confirms hexose transport specificity
Xenopus laevis oocytesNot directly tested for SWEET4, but homologs (e.g., SvSWEET4a) show high-capacity transport
HEK293T CellsValidates glucose transport activity
  • Dominant-Negative Mutants: Coexpression of nonfunctional SWEET4 mutants (e.g., Y57A, G58D) inhibits wild-type transporter activity, confirming oligomer-dependent function .

Evolutionary and Biotechnological Relevance

  • Evolution: SWEET4 belongs to Clade II of the SWEET family, which diverged from Clade III (sucrose transporters) early in plant evolution .

  • Biotech Potential: Engineered SWEET variants could optimize sugar allocation in crops to enhance yield or stress resilience .

Research Gaps and Future Directions

  • Structural Insights: No high-resolution 3D structure exists for SWEET4; homology modeling remains speculative .

  • Regulatory Networks: How SWEET4 interacts with other transporters (e.g., SUTs) in axial tissues is unclear .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SWEET4; At3g28007; MMG15.4; Bidirectional sugar transporter SWEET4; AtSWEET4; Protein SUGARS WILL EVENTUALLY BE EXPORTED TRANSPORTERS 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SWEET4
Target Protein Sequence
MVNATVARNIAGICGNVISLFLFLSPIPTFITIYKKKKVEEYKADPYLATVLNCALWVFY GLPMVQPDSLLVITINGTGLAIELVYLAIFFFFSPTSRKVKVGLWLIGEMVFVGIVATCT LLLFHTHNQRSSFVGIFCVIFVSLMYIAPLTIMSKVIKTKSVKYMPFSLSLANFLNGVVW VIYALIKFDLFILIGNGLGTVSGAVQLILYACYYKTTPKDDEDEEDEENLSKVNSQLQLS GNSGQAKRVSA
Uniprot No.

Target Background

Function
This protein mediates both low-affinity uptake and efflux of sugars across the plasma membrane.
Gene References Into Functions
  1. AtSWEET4 plays a crucial role in mediating sugar transport in axial plant tissues during growth and development. PMID: 27102826
Database Links

KEGG: ath:AT3G28007

STRING: 3702.AT3G28007.1

UniGene: At.26264

Protein Families
SWEET sugar transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is AtSWEET4 and where is it localized in Arabidopsis thaliana?

AtSWEET4 is a member of the SWEET (Sugars Will Eventually be Exported Transporter) gene family that functions as a bidirectional sugar transporter, facilitating the movement of hexoses (primarily glucose and fructose) across the plasma membrane along concentration gradients. YFP-tagged AtSWEET4 protein has been confirmed to localize to the plasma membrane . Promoter-GUS analysis demonstrates that AtSWEET4 is predominantly expressed in the stele of roots and the vascular veins of leaves and flowers, suggesting its specialized role in sugar transport within these axial tissues .

What is the evolutionary significance of the SWEET gene family?

The SWEET gene family is evolutionarily conserved and widely distributed across eukaryotes, animals, bacteria, fungi, and archaea . SWEET proteins contain a characteristic number of conserved transmembrane domains named MTN3/saliva . This high degree of conservation suggests fundamental importance in cellular transport functions across diverse organisms. The membrane proteins encoded by SWEET genes facilitate bidirectional sugar transport by promoting the diffusion of sugars across cell membranes or vacuole membranes along concentration gradients .

How do SWEET transporters differ from other sugar transporters in plants?

SWEET transporters represent a novel class of sugar transporters distinct from previously characterized transporters like SUTs (Sucrose Transporters) and MSTs (Monosaccharide Transporters). While SUTs are active transporters utilizing proton gradients for energy, SWEET proteins facilitate passive, bidirectional transport along concentration gradients. The SWEET family is particularly important for phloem loading and unloading processes, playing key roles in flower and fruit development by facilitating sugar unloading in the phloem . Unlike many other transporters, SWEETs can operate at the plasma membrane or tonoplast, depending on the specific family member.

What are the recommended approaches for studying AtSWEET4 function in Arabidopsis?

To investigate AtSWEET4 function, researchers can employ several complementary approaches:

  • Genetic manipulation techniques:

    • Overexpression lines using the 35S promoter to increase AtSWEET4 expression

    • RNA interference (RNAi) to knock down AtSWEET4 expression

    • CRISPR/Cas9 gene editing for complete knockout

  • Phenotypic analyses:

    • Plant size and morphology measurements

    • Leaf chlorophyll content quantification

    • Vein pattern analysis using microscopy

    • Root architecture examination

  • Biochemical analyses:

    • Quantification of glucose and fructose contents in various tissues

    • Monitoring sugar transport using radiolabeled sugars

  • Promoter analysis:

    • AtSWEET4 promoter-reporter fusion (e.g., GUS) to study tissue-specific expression patterns

How can recombinant AtSWEET4 protein be expressed and purified for in vitro studies?

Based on approaches used for other Arabidopsis proteins:

  • Cloning strategy:

    • Amplify the AtSWEET4 cDNA coding for the mature protein

    • Clone into an expression vector (e.g., pET28a) with a His-tag for purification

    • Confirm the construct by restriction digestion and DNA sequencing

  • Expression system:

    • Transform the construct into E. coli BL21(DE3) cells

    • Induce protein expression with IPTG (typically 0.1-1.0 mM)

    • Optimize temperature, induction time, and IPTG concentration for maximum yield

  • Purification procedure:

    • Lyse cells using appropriate buffer systems with protease inhibitors

    • Perform affinity chromatography using Ni-NTA resin to capture His-tagged protein

    • Consider additional purification steps (ion exchange, size exclusion) if needed

    • Confirm protein identity by western blotting and mass spectrometry

  • Activity assessment:

    • Conduct oxygen uptake measurements to verify functional activity

    • Perform circular dichroism (CD) analysis to assess secondary structure integrity

What methods can be used to assess sugar transport activity of AtSWEET4?

Several complementary approaches can be employed:

  • Heterologous expression systems:

    • Yeast complementation assays using strains deficient in hexose transport

    • Measurement of glucose and fructose uptake in transformed yeast cells

  • Plant-based transport assays:

    • Radiolabeled sugar uptake experiments in protoplasts

    • Sugar export measurements from source tissues

    • Phloem loading/unloading quantification

  • Biophysical techniques:

    • Electrophysiology to measure transport-associated currents

    • Surface plasmon resonance (SPR) to study binding kinetics with substrates

  • In silico modeling:

    • Structural modeling based on known SWEET protein structures

    • Molecular dynamics simulations to predict transport mechanisms

How does AtSWEET4 overexpression or knockdown affect plant phenotype and sugar homeostasis?

Research has revealed significant phenotypic and metabolic changes associated with altered AtSWEET4 expression:

ParameterWild-typeAtSWEET4 OverexpressionAtSWEET4 RNAi Knockdown
Plant sizeNormalIncreasedDecreased
Glucose contentBaselineHigher accumulationReduced
Fructose contentBaselineHigher accumulationReduced
Leaf appearanceNormalEnhanced growthChlorosis in vein network
Chlorophyll contentNormalSimilar to wild-typeReduced
Freezing toleranceBaselineIncreasedNot reported
Pathogen susceptibilityBaselineIncreased growth of P. syringaeNot reported

Overexpression of AtSWEET4 leads to increased plant size and accumulation of glucose and fructose, while knockdown results in smaller plants with reduced hexose content . The chlorosis observed in the leaf vein network of knockdown plants indicates that AtSWEET4 is critical for maintaining proper sugar distribution in vascular tissues. Additionally, AtSWEET4 overexpression enhances freezing tolerance and increases susceptibility to bacterial pathogens like Pseudomonas syringae pv. phaseolicola NPS3121 , suggesting its involvement in both abiotic and biotic stress responses.

What is the functional relationship between AtSWEET4 and other SWEET family members in Arabidopsis?

The SWEET family in Arabidopsis comprises multiple members with distinct but sometimes overlapping functions:

  • Substrate specificity differences:

    • AtSWEET4 primarily transports glucose and fructose (hexoses)

    • AtSWEET11 and AtSWEET12 primarily transport sucrose and are critical for seed filling

    • AtSWEET2 regulates sugar availability from cytosol to vacuole, contributing to resistance against Pythium

  • Tissue-specific expression patterns:

    • AtSWEET4: expressed in stele of roots and veins of leaves and flowers

    • AtSWEET11/12: phloem parenchyma cells, involved in phloem loading

    • AtSWEET16: expressed in vascular tissues, involved in freezing tolerance

  • Functional redundancy analysis:

    • Single mutants may show subtle phenotypes due to compensation by other family members

    • Double or triple mutants can reveal more pronounced phenotypes

    • AtSWEET4 functions appear partially distinct from other family members based on its unique knockdown phenotype

How do experimental conditions affect the transport activity of recombinant AtSWEET4?

Based on studies of recombinant proteins in Arabidopsis:

  • pH dependency:

    • Transport activity may vary across pH range 5.5-8.0

    • Optimal activity typically observed at physiological pH (~7.0)

    • CD spectroscopy can confirm retention of structural integrity across pH ranges

  • Temperature effects:

    • Activity generally increases with temperature up to a physiological optimum

    • Thermal stability can be assessed using CD to monitor secondary structure retention

    • Freezing tolerance phenotype suggests functionality at lower temperatures

  • Substrate concentration:

    • Transport follows typical Michaelis-Menten kinetics

    • Km values for glucose and fructose may differ, affecting transport efficiency

    • Substrate inhibition may occur at very high concentrations

  • Membrane environment:

    • Lipid composition affects insertion, folding, and activity

    • Detergent selection critical for maintaining function during purification

    • Reconstitution into liposomes provides more native-like environment for activity measurements

How can knowledge about AtSWEET4 be translated to crop improvement strategies?

Arabidopsis research on AtSWEET4 provides valuable insights that can be applied to crop plants:

  • Ortholog identification and characterization:

    • Identify SWEET4 orthologs in crop species using Arabidopsis sequence as reference

    • Compare expression patterns and functions across species

    • SWEET4 proteins in rice and maize facilitate hexose transport across endosperm, supporting cereal grain development

  • Yield enhancement strategies:

    • Manipulate expression of SWEET4 orthologs to increase sugar transport to developing fruits and seeds

    • Fine-tune expression patterns to optimize source-sink relationships

    • Engineer tissue-specific promoters to drive expression in targeted tissues

  • Stress tolerance improvement:

    • Utilize SWEET4's role in freezing tolerance for developing cold-resistant crop varieties

    • Balance pathogen susceptibility concerns with potential benefits in yield and stress tolerance

    • Develop SWEET4 variants with modified regulatory regions to maintain beneficial functions while minimizing pathogen exploitation

What are the methodological challenges in studying SWEET4 orthologs in polyploid crop species?

Translating AtSWEET4 research to polyploid crops presents several challenges:

  • Genetic redundancy issues:

    • Multiple gene copies may exist due to polyploidy

    • Functional redundancy can mask phenotypes in single-gene knockouts

    • CRISPR/Cas9 multiplexing approaches may be necessary to target all homeologs

  • Transformation difficulties:

    • Many crop species are recalcitrant to transformation

    • Tissue-specific promoters from Arabidopsis may not function similarly in crops

    • Alternative approaches like Arabidopsis complementation can provide initial functional insights

  • Complex developmental processes:

    • Crop development patterns differ from Arabidopsis

    • Tissue-specific expression patterns may vary between species

    • Developmental timing of SWEET4 expression may be critical for function

  • Synteny and conservation analysis:

    • Decreased synteny between Arabidopsis and distantly related crops complicates ortholog identification

    • Functional diversification may occur despite sequence conservation

    • Complementation studies in Arabidopsis can verify conserved functions

How can computational approaches facilitate translation of AtSWEET4 research to other plant species?

Computational methods play a crucial role in extending AtSWEET4 findings to other plants:

  • Ortholog identification strategies:

    • Reciprocal BLAST searches to identify putative orthologs

    • Phylogenetic analysis to confirm evolutionary relationships

    • Synteny analysis to identify conserved genomic contexts

    • Gene structure comparison (exon/intron organization)

  • Promoter analysis tools:

    • Identify conserved cis-regulatory elements between AtSWEET4 and crop orthologs

    • Predict expression patterns based on promoter architecture

    • Design synthetic promoters combining beneficial regulatory elements

  • Protein structure prediction:

    • Generate 3D models of crop SWEET4 orthologs based on known structures

    • Identify conserved substrate binding domains

    • Predict functional differences based on structural variations

  • Network analysis approaches:

    • Construct sugar transport regulatory networks based on Arabidopsis data

    • Translate these networks to crop species using orthology relationships

    • Identify key regulatory hubs that might be conserved across species

What are common challenges in expressing recombinant AtSWEET4 and how can they be addressed?

Membrane protein expression presents specific challenges:

  • Protein toxicity issues:

    • Use tightly controlled inducible promoters

    • Optimize induction conditions (lower IPTG concentration, reduced temperature)

    • Consider specialized E. coli strains designed for toxic protein expression

  • Inclusion body formation:

    • Express at lower temperatures (16-20°C) to slow folding

    • Use solubility-enhancing fusion tags (MBP, SUMO)

    • Develop refolding protocols if inclusion bodies persist

    • Consider cell-free expression systems

  • Low protein yield:

    • Optimize codon usage for expression host

    • Test different growth media and conditions

    • Consider alternative expression systems (yeast, insect cells)

    • Scale up culture volumes to compensate for lower per-cell yield

  • Purification challenges:

    • Screen multiple detergents for optimal extraction

    • Implement two-step purification (affinity followed by size exclusion)

    • Include stabilizing agents in buffers (glycerol, specific lipids)

    • Verify protein activity after each purification step

How can sugar transport activity assays for AtSWEET4 be optimized and validated?

Several considerations for robust activity assays:

  • Yeast complementation optimization:

    • Select appropriate yeast strain lacking endogenous transporters

    • Optimize growth conditions and media composition

    • Use concentration gradients of sugars to establish kinetic parameters

    • Include positive controls (known transporters) and negative controls (empty vectors)

  • Radioisotope uptake considerations:

    • Select appropriate isotopes (14C-glucose, 14C-fructose)

    • Optimize incubation times to capture initial rates

    • Use inhibitors to confirm specificity

    • Implement time-course measurements to distinguish transport from metabolism

  • Proteoliposome reconstitution:

    • Select lipid composition mimicking native membrane environment

    • Optimize protein:lipid ratios

    • Verify protein orientation in liposomes

    • Include ionophores to eliminate confounding membrane potential effects

  • Validation approaches:

    • Mutate key residues to create non-functional controls

    • Compare kinetic parameters with in planta phenotypes

    • Correlate transport activity with structural integrity measurements

What are promising approaches for studying the structure-function relationship of AtSWEET4?

Despite significant functional characterization, structural insights remain limited:

  • Structural biology approaches:

    • X-ray crystallography of purified recombinant AtSWEET4

    • Cryo-electron microscopy for high-resolution structure determination

    • NMR studies of specific domains or peptides

    • Molecular dynamics simulations based on homology models

  • Mutagenesis strategies:

    • Alanine scanning of transmembrane domains

    • Targeted mutations of predicted substrate binding residues

    • Creation of chimeric proteins with other SWEET family members

    • CRISPR/Cas9 base editing for precise amino acid substitutions

  • Conformational dynamics studies:

    • Fluorescence resonance energy transfer (FRET) to monitor conformational changes

    • Hydrogen-deuterium exchange mass spectrometry

    • Single-molecule approaches to capture transport cycle intermediates

    • Electrophysiology to measure transport-associated currents

  • Interaction studies:

    • Identify protein interaction partners using co-immunoprecipitation

    • Investigate regulatory protein complexes

    • Study lipid-protein interactions that may modulate activity

How might multi-omics approaches enhance our understanding of AtSWEET4 function in sugar homeostasis?

Integrated approaches offer comprehensive insights:

  • Transcriptomics applications:

    • RNA-seq of AtSWEET4 overexpression and knockdown lines

    • Single-cell transcriptomics to reveal cell-specific responses

    • Time-course analyses during development and stress responses

    • Comparison with other sugar transport mutants

  • Metabolomics strategies:

    • Comprehensive sugar profiling in different tissues

    • Flux analysis using stable isotope labeling

    • Spatial metabolomics to map sugar distributions

    • Integration with transcriptomics to identify metabolic bottlenecks

  • Proteomics approaches:

    • Quantitative proteomics of membrane fractions

    • Post-translational modification analysis

    • Protein turnover studies

    • Interactome mapping focused on sugar transport machinery

  • Systems biology integration:

    • Mathematical modeling of sugar transport networks

    • Prediction of emergent properties from component interactions

    • Identification of key regulatory nodes for targeted manipulation

    • Multi-scale modeling from molecular to whole-plant levels

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.