Recombinant Arabidopsis thaliana Bidirectional sugar transporter SWEET5 (SWEET5)

Shipped with Ice Packs
In Stock

Description

Key Features of SWEET5

ParameterDetails
Protein Structure7 transmembrane helices (3+1+3 arrangement), ~240 amino acids
Gene NameSWEET5, AtVEX1, VEX1 (Locus: At5g62850)
SubstratesGlucose, galactose
LocalizationPlasma membrane (pollen, leaves)
Expression PatternHigh in mature pollen; peaks at tricellular stage; declines post-germination

Functional Roles and Biological Significance

SWEET5 plays critical roles in plant sugar metabolism and stress responses:

Pollen Germination and Galactose Sensitivity

SWEET5 is essential for galactose uptake in pollen, where excess galactose inhibits germination. Studies show:

  • Mechanism: SWEET5 transports galactose into pollen, which is phosphorylated by galactokinase (GALK), leading to metabolic disruption .

  • Phenotype: sweet5 mutants exhibit galactose insensitivity, with restored germination rates compared to wild-type .

  • Protein Dynamics: SWEET5 accumulates in mature pollen grains but rapidly degrades post-germination .

Stress Response and Sugar Homeostasis

While SWEET5 itself is not directly stress-inducible, its role in apoplastic sugar retrieval aligns with broader plant stress adaptation:

  • Galactose Metabolism: Collaborates with GALK to regulate galactose flux, preventing toxic accumulation .

  • Evolutionary Context: Part of the Clade I SWEETs (e.g., AtSWEET1), which transport hexoses (glucose, galactose) .

Research Applications of Recombinant SWEET5

The recombinant protein is widely used for biochemical and biophysical studies:

ApplicationDetails
ELISA/Western BlottingDetect SWEET5 expression in plant tissues or recombinant systems
Functional AssaysCharacterize substrate specificity (glucose vs. galactose)
Localization StudiesConfirm plasma membrane targeting via GFP/YFP fusion
Protein PurificationProduced via E. coli or mammalian systems; >85% purity

Comparative Analysis with Other SWEET Family Members

SWEET5 belongs to a diverse transporter family with distinct substrate specificities:

TransporterSubstratesPrimary FunctionClade
SWEET5Glucose, GalactosePollen nutrition, galactose sensitivityI
AtSWEET1GlucoseSeed filling, nectar secretionI
AtSWEET11/12SucrosePhloem loading/unloadingIII
AtSWEET17FructoseFruit developmentIV

Source:

Production and Handling of Recombinant SWEET5

Recombinant SWEET5 is commercially available in optimized forms:

ParameterRecombinant SWEET5
Host SystemE. coli, yeast, or mammalian cells
Purity≥85% (SDS-PAGE validated)
Storage-20°C (long-term), 4°C (short-term)
BufferTris-based buffer with 50% glycerol

Key Research Findings and Implications

  1. Galactose Toxicity Mechanism: SWEET5-mediated galactose uptake disrupts pollen germination via GALK-dependent phosphorylation, creating a metabolic bottleneck .

  2. Evolutionary Divergence: Clade I SWEETs (e.g., SWEET5) evolved to prioritize hexose transport, while Clade III specializes in sucrose .

  3. Agricultural Relevance: Engineering SWEET5 expression may improve crop resilience to sugar-related stresses or enhance pollen viability .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life is influenced by numerous factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SWEET5; VEX1; At5g62850; MQB2.17; Bidirectional sugar transporter SWEET5; AtSWEET5; Protein SUGARS WILL EVENTUALLY BE EXPORTED TRANSPORTERS 5; Protein VEGETATIVE CELL EXPRESSED 1; AtVEX1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-240
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SWEET5
Target Protein Sequence
MTDPHTARTIVGIVGNVISFGLFCAPIPTMVKIWKMKSVSEFKPDPYVATVLNCMMWTFY GLPFVQPDSLLVITINGTGLFMELVYVTIFFVFATSPVRRKITIAMVIEVIFMAVVIFCT MYFLHTTKQRSMLIGILCIVFNVIMYAAPLTVMKLVIKTKSVKYMPFFLSLANFMNGVVW VIYACLKFDPYILIPNGLGSLSGIIQLIIYITYYKTTNWNDDDEDKEKRYSNAGIELGQA
Uniprot No.

Target Background

Function
This protein facilitates both low-affinity uptake and efflux of sugar across the plasma membrane. It may play crucial roles in supporting male gametophyte development.
Database Links

KEGG: ath:AT5G62850

STRING: 3702.AT5G62850.1

UniGene: At.55685

Protein Families
SWEET sugar transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is SWEET5 and which clade does it belong to within the SWEET family?

SWEET5 is a bidirectional sugar transporter belonging to clade II (SWEET3-8) of the SWEET family in Arabidopsis thaliana. Like other members of clade II, SWEET5 predominantly transports monosaccharides rather than disaccharides . The SWEET family in angiosperms typically consists of approximately 20 paralogs divided into four clades, with members of clades I, II, and IV primarily transporting monosaccharides, while clade III members mainly transport sucrose .

What sugars does SWEET5 transport and what is its transport mechanism?

SWEET5 functions as a bidirectional uniporter/facilitator that mediates both uptake and efflux of monosaccharides, specifically glucose and galactose . Transport activity studies have confirmed its ability to transport both these hexoses with low affinity but high capacity. The transport mechanism is relatively pH-independent, which distinguishes it from some other sugar transport systems. This bidirectional capability makes SWEET5 particularly important for intracellular and intercellular sugar translocation .

Where is SWEET5 localized at the subcellular level?

SWEET5 is predominantly localized to the plasma membrane, as confirmed by fluorescence microscopy studies using SWEET5-YFP fusion proteins . In pavement cells, SWEET5 protein was observed at the cell periphery, enclosing both chloroplasts and Golgi apparatus, consistent with plasma membrane localization . This localization pattern aligns with most Arabidopsis SWEETs (SWEET1, 8, 9, 11, 12, and 15), which are found in the plasma membrane, unlike SWEET2, SWEET16, and SWEET17 that localize to the tonoplast, or SWEET9 that can also be found in the Golgi membrane .

What is the temporal expression pattern of SWEET5 during pollen development?

SWEET5 exhibits a highly specific temporal expression pattern during pollen development. Studies using SWEET5-YFP translational fusions show that SWEET5 protein first becomes detectable at the tricellular stage of pollen development . Protein accumulation begins in immature pollen grains from flower stage 11, corresponding to when pollen mitosis I and II occur . SWEET5 protein levels continue to increase, reaching peak expression in mature pollen grains at flower stage 13 (anthesis) . Notably, SWEET5 protein levels decline rapidly after pollen germination, with substantially reduced levels observed in germinated pollen and pollen tubes compared to non-germinated pollen grains .

What tissues express SWEET5 in Arabidopsis thaliana?

SWEET5 expression is highly tissue-specific. The highest expression is found almost exclusively in anthers and mature pollen at late stages of flower development, as demonstrated by both GUS staining and YFP fluorescence studies . While some GUS staining has been detected at the early seedling stage with a preference for the vein, the predominant expression remains in reproductive tissues . This highly specific expression pattern suggests a specialized role for SWEET5 in reproductive processes rather than in vegetative growth or development .

How can researchers monitor SWEET5 expression in planta?

Researchers can monitor SWEET5 expression using several complementary approaches. Translational fusions with reporter genes, such as β-glucuronidase (GUS) or yellow fluorescent protein (YFP) driven by the native SWEET5 promoter, allow for visualization of spatial and temporal expression patterns . Fluorescence microscopy can be used to track SWEET5-YFP protein accumulation during different developmental stages. For more quantitative analysis, RT-PCR or RNA-seq can assess transcript levels. Additionally, propidium iodide (PI) staining can be used concurrently to visualize cell walls and nuclei, helping to delineate specific developmental stages such as uninucleate microspores (UNMs), bicellular pollen (BCP), and tricellular/mature pollen grains when examining SWEET5 expression .

How does SWEET5 affect galactose sensitivity during pollen germination?

SWEET5 plays a critical role in mediating galactose sensitivity during pollen germination. Research demonstrates that SWEET5 protein levels are directly correlated with dosage-dependent sensitivity to galactose during in vitro pollen germination . Wild-type Arabidopsis (Col-0) pollen germination rates are dramatically reduced from 57% to 11% when exposed to 60 mM galactose . In contrast, SWEET5 loss-of-function mutants (both T-DNA insertion and CRISPR/Cas9-edited lines) show significant resistance to galactose inhibition . Complementation studies confirm this phenotype, as transforming mutant lines with constructs carrying the SWEET5 promoter driving either endogenous SWEET5 or a synonymous mSWEET5 fully restores galactose sensitivity . Furthermore, SWEET5 overexpression lines exhibit enhanced sensitivity to galactose compared to wild-type plants, with germination particularly affected at concentrations ≥6 mM galactose .

What is the relationship between SWEET5 and galactokinase (GALK) in pollen germination?

SWEET5 functions in conjunction with galactokinase (GALK) to regulate galactose-mediated inhibition of pollen germination . While SWEET5 facilitates galactose transport across the plasma membrane, GALK is the first enzyme that catalyzes galactose phosphorylation after entry into the cell . Research demonstrates that both proteins are essential for the inhibitory effects of galactose on pollen germination. The data suggest a model where SWEET5 transports galactose into pollen cells, which is then phosphorylated by GALK, resulting in inhibition of pollen germination through mechanisms that remain to be fully elucidated . Sugar metabolism studies indicate that the dynamics of galactose flux and metabolism, rather than steady-state galactose levels, may be responsible for the phenotypic differences between sweet5 mutants and wild-type plants in galactose inhibition of pollen germination .

How can researchers generate and validate SWEET5 mutant lines?

Researchers can generate SWEET5 mutant lines through multiple approaches. T-DNA insertion lines can be obtained from established collections, while CRISPR/Cas9 gene editing provides a more targeted approach for creating knockout or specific mutations . To validate these mutants, researchers should employ multiple complementary methods. RT-PCR and qRT-PCR can confirm reduced or absent transcript levels. Western blotting with SWEET5-specific antibodies can verify protein absence. Phenotypic analysis using galactose sensitivity assays provides functional validation, as sweet5 mutants should show resistance to galactose inhibition of pollen germination . For complete validation, complementation studies should be performed by transforming mutant lines with the native SWEET5 gene under its endogenous promoter, which should restore the wild-type phenotype .

What methods can be used to assess sugar transport activity of SWEET5?

Multiple complementary approaches can be used to assess SWEET5's sugar transport activity:

  • Heterologous expression systems: Express SWEET5 in yeast cells and conduct growth assays with various sugars as the sole carbon source .

  • Radioactive tracer uptake assays: Use 14C-labeled sugars (e.g., 14C-galactose) to measure uptake rates in both wild-type and sweet5 mutant pollen . Collect germinating pollen after a standardized hydration period (e.g., 45 minutes in liquid pollen germination medium) to minimize interference from transporters expressed during pollen tube growth .

  • FRET sensor assays: Co-express SWEET5 with high-sensitivity FRET glucose sensors (e.g., FLIPglu600mD13V) in systems with low endogenous glucose uptake activity, such as human HEK293T cells . This allows real-time monitoring of sugar transport across membranes.

  • In planta sugar measurements: Quantify sugar content in wild-type, mutant, and overexpression lines using high-performance liquid chromatography (HPLC) or enzymatic assays to correlate SWEET5 activity with sugar levels .

These methodologies provide complementary data on transport kinetics, substrate specificity, and physiological relevance of SWEET5-mediated sugar transport.

How can pollen germination assays be optimized to study SWEET5 function?

To optimize pollen germination assays for studying SWEET5 function, researchers should:

  • Use standardized pollen germination medium (PGM) with well-defined compositions. For galactose inhibition studies, supplement the standard PGM with various concentrations of galactose (6-60 mM) .

  • Include appropriate controls by testing the effects of other sugars (glucose, fructose) at equivalent concentrations to confirm specific effects of galactose . Research shows that 60 mM glucose or fructose does not affect germination rates, whereas galactose does .

  • Implement consistent collection and handling procedures for pollen, as pollen viability can vary with plant age and growth conditions.

  • Use multiple genotypes in each experiment: wild-type (Col-0), sweet5 mutants, complementation lines, and overexpression lines to establish dose-response relationships .

  • Quantify germination rates by counting at least 300 pollen grains per replicate across multiple biological replicates .

  • For in vivo studies, perform hand-pollination followed by aniline blue staining to visualize pollen tubes at defined time points after pollination (e.g., 2 and 6 hours) .

  • Consider environmental factors that might affect galactose content in plant tissues, as stress conditions can alter sugar metabolism and cell wall composition .

How does SWEET5 function differ from other pollen-expressed SWEET transporters?

Several SWEET transporters are expressed in pollen, but they exhibit distinct functions and expression patterns. AtSWEET8, unlike SWEET5, is highly expressed in the tapetum and plays a crucial role in providing glucose for pollen nutrition, with atsweet8 mutants showing male sterility due to nonviable pollen grains . AtSWEET15 (also known as VEX1) is expressed in pollen grains and involved in sugar transport, particularly in vegetative cells, and maintains expression during pollen maturation and germination . In rice, OsSWEET11 is highly expressed in pollen grains and contributes to pollen viability, with knockout mutants showing reduced starch content and potential male sterility .

SWEET5 differs in that it specifically peaks in mature pollen and rapidly declines after germination . Unlike AtSWEET8, SWEET5 loss-of-function does not cause male sterility under normal conditions but instead affects galactose sensitivity during in vitro pollen germination . This suggests SWEET5 may play a more specialized role in regulating sugar homeostasis during the crucial transition from mature pollen to germinating pollen, particularly under conditions where galactose levels are elevated .

What molecular mechanisms might explain galactose-induced inhibition of pollen germination mediated by SWEET5?

The molecular mechanisms underlying SWEET5-mediated galactose inhibition of pollen germination remain incompletely understood, but current research suggests several possibilities:

  • Metabolic disruption: SWEET5 transports galactose into pollen cells, where it is phosphorylated by GALK . Accumulated galactose-1-phosphate may disrupt normal carbohydrate metabolism by inhibiting phosphoglucomutase or other enzymes in glycolysis .

  • Sugar sensing and signaling: Increased intracellular galactose may trigger sugar-sensing pathways that negatively regulate pollen germination. The rapid decline in SWEET5 protein levels after germination suggests tight regulation of sugar transport during this critical developmental transition .

  • Energy depletion: Galactose metabolism requires ATP for phosphorylation by GALK. Excessive galactose uptake via SWEET5 may drain cellular energy resources needed for pollen germination and tube growth .

  • Cell wall synthesis interference: Galactose is a component of cell wall polysaccharides. Abnormal galactose levels might interfere with proper cell wall synthesis during pollen tube formation .

  • Sugar flux dynamics: Research indicates that galactose flux dynamics and sugar metabolism, rather than steady-state galactose levels, may explain the phenotypic differences between sweet5 mutants and wild-type plants . This suggests that the rate of galactose transport mediated by SWEET5, rather than absolute concentrations, might be the critical factor.

What potential roles might SWEET5 play under stress conditions affecting plant reproduction?

While SWEET5 does not appear to affect in vivo pollen germination under normal conditions, several lines of evidence suggest it might play important roles under stress conditions:

  • Stress-induced galactose accumulation: Under stress conditions, plants often modify their cell walls, potentially releasing galactose. For example, coffee plants (Coffea arabica) significantly increase soluble galactose content under heat stress . If similar processes occur in Arabidopsis reproductive tissues during stress, SWEET5 might mediate adaptive responses by regulating galactose flux.

  • Reproductive resilience: The highly specialized expression pattern of SWEET5, peaking in mature pollen and rapidly declining after germination, suggests a potential role in sugar homeostasis during the critical period when pollen is exposed to environmental stressors before and during germination .

  • Sugar reallocation: Under stress conditions, plants often redistribute carbohydrates to prioritize reproductive success. SWEET5 might participate in this process by facilitating sugar transport to or from developing pollen, potentially contributing to reproductive resilience under suboptimal conditions .

  • Pathogen response: Other SWEET transporters are targets for pathogens seeking to access plant sugars . Although not documented for SWEET5 specifically, its presence in reproductive tissues might play a role in pathogen resistance during flowering, particularly if pathogens attempt to manipulate sugar availability in these tissues.

  • Coordination with stress signaling: The rapid reduction in SWEET5 protein levels after pollen germination suggests tight regulation . This regulation might be integrated with stress signaling pathways to optimize reproductive success under changing environmental conditions.

These potential roles remain speculative and represent promising areas for future research on SWEET5 function under stress conditions affecting plant reproduction.

What are the key unanswered questions about SWEET5 function and regulation?

Despite significant progress in understanding SWEET5, several important questions remain unanswered:

  • What transcription factors and regulatory elements control the highly specific expression pattern of SWEET5 during pollen development?

  • How is the rapid decline in SWEET5 protein levels after pollen germination regulated at the post-transcriptional and post-translational levels?

  • Does SWEET5 interact with other proteins, particularly other sugar transporters or metabolic enzymes, to coordinate sugar homeostasis during pollen development and germination?

  • What are the precise mechanisms by which galactose inhibits pollen germination, and how do SWEET5 and GALK contribute to these mechanisms at the molecular level?

  • How does SWEET5 function change under various biotic and abiotic stress conditions that might affect reproductive success?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.