Recombinant Arabidopsis thaliana Bidirectional sugar transporter SWEET7 (SWEET7)

Shipped with Ice Packs
In Stock

Description

Introduction to SWEET7 Protein

SWEET7 (Sugars Will Eventually be Exported Transporters 7) is a membrane-bound protein identified in the model plant organism Arabidopsis thaliana. It belongs to the SWEET family of transporters, which are characterized by their ability to facilitate bidirectional movement of sugars across cell membranes . The SWEET7 protein, also known as AtSWEET7, is encoded by the gene At4g10850 and is alternatively annotated as F25I24.60 or F8M12.20 in various databases .

SWEET7 is a relatively small protein consisting of 258 amino acids with a molecular weight of approximately 28,531 Daltons . Unlike traditional sugar transporters that rely on proton gradients for active transport, SWEET7 utilizes concentration gradients to move sugars in either direction across membranes . This bidirectional capability makes SWEET proteins, including SWEET7, particularly interesting for understanding fundamental aspects of plant carbohydrate allocation and potentially for biotechnological applications.

In Arabidopsis thaliana, the SWEET family comprises 17 members categorized into four clades based on phylogenetic relationships . SWEET7 belongs to Clade II (which includes SWEET4, SWEET5, SWEET6, SWEET7, and SWEET8), a subfamily that predominantly specializes in hexose transport . This classification provides important context for understanding SWEET7's functional role within the broader sugar transport network in plants.

Membrane Topology and Transmembrane Segments

SWEET7 features a distinctive membrane topology that differs significantly from other classes of sugar transporters. The protein contains seven transmembrane segments (TMSs) arranged in a unique "3-1-3" configuration . This architecture consists of:

  1. An N-terminal triple-helix bundle (THB1) comprising the first three TMSs

  2. A central less-conserved TM4 that acts primarily as a linker

  3. A C-terminal triple-helix bundle (THB2) comprising the final three TMSs

This arrangement creates two MtN3/saliva domains (a conserved domain found in the SWEET family), with each domain containing three TMSs . The N-terminus of the protein is located outside the cytoplasm, while the C-terminus resides inside .

The "3-1-3" topology represents a significant evolutionary development compared to prokaryotic SemiSWEET transporters, which contain only one MtN3/saliva domain with three TMSs . The eukaryotic SWEET structure likely evolved through duplication of this prokaryotic domain, enabling more complex sugar transport capabilities .

Bidirectional Transport Properties

SWEET7 operates fundamentally differently from many other sugar transporters in plants. Unlike Major Facilitator Superfamily (MFS) transporters such as Monosaccharide Transporters (MSTs) and Sucrose Transporters (SUTs) that couple sugar movement to proton gradients, SWEET7 functions independently of proton coupling .

The transport mechanism of SWEET7 relies solely on the concentration gradient of sugars across the membrane . This allows the protein to facilitate sugar movement in both directions—either from inside the cell to the extracellular space or vice versa—depending on the prevailing concentration gradient . This passive transport mechanism makes SWEET7's function relatively independent of pH conditions, distinguishing it from proton-coupled transporters whose activity is sensitive to pH changes.

Substrate Range and Specificity

SWEET7 displays remarkable substrate versatility compared to many other sugar transporters. Research has demonstrated that SWEET7 can transport:

  1. Glucose

  2. Xylose

What makes SWEET7 particularly interesting is its ability to transport both glucose and xylose simultaneously without mutual inhibition . This contrasts with some other sugar transporters like LST1_205437, which exhibits glucose inhibition of xylose transport .

The substrate specificity of SWEET7 aligns with its classification within Clade II of the SWEET family, which predominantly specializes in hexose transport . This clade-specific substrate preference reflects evolutionary adaptations to different physiological requirements for sugar transport in plants.

Molecular Basis for Dual Sugar Transport

The molecular basis for SWEET7's ability to transport multiple sugars simultaneously has been investigated through docking studies. These analyses revealed that the sugar-binding pocket of SWEET7 contains key residues (Trp59, Trp183, Asn145, and Asn179) that create an environment capable of accommodating both glucose and xylose molecules .

The arrangement of these residues allows both sugar types to be recognized and transported without competing for the same binding site, explaining the lack of inhibition between glucose and xylose transport . This structural adaptation may provide ecological advantages by allowing more efficient sugar allocation under varying environmental conditions.

Expression Systems and Purification

Recombinant SWEET7 protein has been successfully produced in Escherichia coli expression systems. The full-length protein (amino acids 1-258) can be expressed with an N-terminal histidine tag to facilitate purification . This approach yields functional protein that can be used for structural studies and functional characterization.

The recombinant protein production process typically involves:

  1. Cloning the SWEET7 gene into an appropriate expression vector

  2. Transformation into E. coli expression hosts

  3. Induction of protein expression

  4. Cell lysis and protein extraction

  5. Purification using affinity chromatography (utilizing the His-tag)

  6. Quality assessment by SDS-PAGE

The purified recombinant protein is typically obtained as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE analysis .

Functional Validation of Recombinant SWEET7

Functional validation of recombinant SWEET7 typically involves transport assays to confirm that the protein retains its native sugar transport capabilities. Though specific validation data for recombinant SWEET7 is limited in the available sources, similar SWEET family proteins have been validated through:

  1. Heterologous expression in yeast or Xenopus oocytes to assess transport activity

  2. Radioactive or fluorescent sugar uptake assays

  3. Competition assays to evaluate substrate specificity

  4. Electrophysiological measurements to characterize transport kinetics

These approaches provide confirmation that recombinant SWEET7 maintains its natural bidirectional transport properties and substrate specificities when produced in heterologous systems.

Expression Patterns and Tissue Localization

SWEET7 shows specific expression patterns in Arabidopsis thaliana that provide clues about its physiological roles. Research has demonstrated that SWEET7 is expressed in pollen and may be involved in reproductive development . This expression pattern suggests potential roles in carbohydrate allocation during pollen development and function.

The cell-specific localization of SWEET7 within plant tissues indicates its placement in the plasma membrane , positioning it to facilitate sugar exchange between cellular compartments and the extracellular space. This membrane localization is consistent with its proposed role in bidirectional sugar transport across cellular boundaries.

Physiological Roles in Plant Development

While the precise physiological roles of SWEET7 are still being elucidated, its expression in pollen suggests involvement in reproductive processes . Sugar transport is critical during pollen development, germination, and tube growth, as these processes require substantial energy resources.

The ability of SWEET7 to transport both glucose and xylose simultaneously may be particularly advantageous during pollen development, allowing flexible utilization of different sugar resources depending on availability. This multi-substrate capability could provide adaptive advantages under varying environmental conditions or developmental stages.

Other SWEET family members in Arabidopsis have established roles in processes such as:

  • Phloem loading (SWEET11 and SWEET12)

  • Nectar secretion (SWEET9)

  • Seed filling (SWEET11, SWEET12, and SWEET15)

  • Pollen development (SWEET8)

SWEET7's functions likely complement these established roles, contributing to the comprehensive sugar transport network required for plant growth and development.

Phylogenetic Relationships Within the SWEET Family

SWEET7 belongs to a family of sugar transporters that has undergone significant diversification throughout plant evolution. In Arabidopsis thaliana, 17 SWEET genes have been identified, which are classified into four clades (I-IV) based on sequence similarity and phylogenetic relationships .

SWEET7 is categorized within Clade II, which includes SWEET4, SWEET5, SWEET6, SWEET7, and SWEET8 . This clade specializes in hexose transport, distinguishing it from Clade III (which primarily transports sucrose) and Clade IV (which tends to transport fructose across the vacuolar membrane) .

The evolutionary relationships among SWEET proteins provide important context for understanding the specialized functions of SWEET7 within the broader sugar transport network in plants.

Evolutionary Origin of the SWEET Structure

The distinctive 7-TM structure of eukaryotic SWEET proteins, including SWEET7, appears to have evolved through duplication of a simpler 3-TM structure found in prokaryotic SemiSWEET proteins . This evolutionary transition from a single MtN3/saliva domain to the dual-domain structure found in SWEET7 likely facilitated more complex sugar transport capabilities in eukaryotes .

Interestingly, SWEET proteins in unicellular algae contain 7-TMs but have not yet formed conserved triple-helix bundle (THB) units . This observation suggests that multicellular plants may have acquired the 3-TM structure through horizontal gene transfer from symbiotic bacteria or through internal gene duplication events .

The evolutionary trajectory of SWEET proteins illustrates how structural complexity has increased over time to accommodate the more sophisticated sugar transport requirements of multicellular plant organisms.

Biotechnological Applications

The unique properties of SWEET7, particularly its ability to transport multiple sugars simultaneously without inhibition, make it a promising candidate for various biotechnological applications:

  1. Engineering improved biofuel production systems through enhanced sugar uptake in fermentative microorganisms

  2. Developing crops with altered sugar allocation patterns for improved yield or stress resistance

  3. Creating biosensors for detecting sugars in various environments

  4. Enhancing sugar uptake in industrial fermentation processes

The recombinant production of SWEET7 provides a valuable tool for exploring these potential applications through controlled experimental systems.

Unresolved Questions and Future Research Directions

Despite significant advances in understanding SWEET7 structure and function, several important questions remain for future research:

  1. Detailed three-dimensional structure of SWEET7 at atomic resolution

  2. Complete characterization of the oligomerization states of SWEET7 in vivo

  3. Comprehensive substrate profile beyond glucose and xylose

  4. Regulatory mechanisms controlling SWEET7 expression and activity

  5. Potential interactions with other membrane proteins and cellular components

  6. Roles in plant responses to environmental stresses

  7. Comparative analysis of SWEET7 function across different plant species

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, molecular genetics, and plant physiology. Advanced techniques such as cryo-electron microscopy, molecular dynamics simulations, and CRISPR-based gene editing will likely play important roles in future SWEET7 research.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it when placing the order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing it for you.
Synonyms
SWEET7; At4g10850; F25I24.60; F8M12.20; Bidirectional sugar transporter SWEET7; AtSWEET7; Protein SUGARS WILL EVENTUALLY BE EXPORTED TRANSPORTERS 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-258
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SWEET7
Target Protein Sequence
MVFAHLNLLRKIVGIIGNFIALCLFLSPTPTFVRIVKKKSVEEYSPIPYLATLINCLVWV LYGLPTVHPDSTLVITINGTGILIEIVFLTIFFVYCGRQKQRLIISAVIAAETAFIAILA VLVLTLQHTTEKRTMSVGIVCCVFNVMMYASPLSVMKMVIKTKSVEFMPFWLSVAGFLNA GVWTIYALMPFDPFMAIPNGIGCLFGLAQLILYGAYYKSTKRIMAERENQPGYVGLSSAI ARTGSEKTANTNQEPNNV
Uniprot No.

Target Background

Function
This protein mediates both low-affinity uptake and efflux of sugar across the plasma membrane.
Database Links

KEGG: ath:AT4G10850

STRING: 3702.AT4G10850.1

UniGene: At.3034

Protein Families
SWEET sugar transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the SWEET7 transporter and what is its role in Arabidopsis thaliana?

SWEET7 (Q8LBF7) is a member of the Sugars Will Eventually be Exported Transporters (SWEET) family in Arabidopsis thaliana. It functions as a bidirectional sugar transporter that facilitates the diffusion of sugars across cell membranes. While specific research on SWEET7 is limited, the SWEET family generally plays important roles in various physiological processes including nutrient transport and abiotic stress adaptation. Like other SWEET transporters, SWEET7 likely acts as a uniporter, facilitating sugar movement according to concentration gradients .

What expression systems are typically used for producing recombinant SWEET7?

While specific information about SWEET7 expression is limited in the search results, recombinant membrane proteins from Arabidopsis thaliana are typically expressed using several systems:

  • Yeast expression systems: Pichia pastoris has been successfully used for expressing other membrane transporters from Arabidopsis, allowing for post-translational modifications while providing high yield. This system was effectively used for AtENT7 expression and could be suitable for SWEET7 .

  • Insect cell expression systems: Baculovirus-infected insect cells often provide proper folding and post-translational modifications for plant membrane proteins.

  • Plant-based expression systems: Transient expression in Nicotiana benthamiana or stable transformation in Arabidopsis cell cultures can preserve native folding and modifications.

Each system has advantages depending on research goals, with yeast systems typically offering a balance between yield and proper folding for functional studies .

What are the optimal buffer conditions for maintaining SWEET7 stability during purification?

Based on experience with similar membrane transporters from Arabidopsis thaliana, the following buffer system is recommended for SWEET7 purification:

Buffer ComponentConcentrationPurpose
Tris-HCl (pH 7.5-8.0)20-50 mMMaintains physiological pH
NaCl150-300 mMProvides ionic strength
Glycerol10-20%Stabilizes protein structure
Detergent (DDM or LMNG)0.02-0.05%Maintains solubility
Protease inhibitorsAs recommendedPrevents degradation

Additionally, including 50% glycerol in the final storage buffer significantly enhances stability for long-term storage at -20°C or -80°C, as observed with other Arabidopsis transporters. Avoiding repeated freeze-thaw cycles is critical for maintaining SWEET7 functionality .

How can researchers verify the functional activity of purified recombinant SWEET7?

Functional verification of recombinant SWEET7 can be performed through several complementary approaches:

  • Substrate binding assays: Microscale thermophoresis (MST) has proven effective for characterizing the substrate binding properties of membrane transporters. For SWEET7, this technique can assess binding affinities for various sugars .

  • Reconstitution into liposomes: SWEET7 can be incorporated into artificial lipid vesicles to measure sugar transport using fluorescent sugar analogs or radiolabeled substrates.

  • Heterologous expression systems: Functional activity can be assessed through expression in Xenopus laevis oocytes followed by electrophysiological measurements or uptake assays with labeled substrates, similar to the approach used for AtENT7 .

  • Complementation assays: Expression of SWEET7 in yeast mutants deficient in sugar transport can demonstrate functionality if growth is restored on sugar-containing media.

Each approach provides different insights into transporter function, with a combination of methods providing the most comprehensive characterization .

How does the oligomeric state of SWEET7 influence its transport mechanism?

Current understanding of SWEET transporters suggests their function may depend on oligomerization, though specific data for SWEET7 is limited. Based on studies of related transporters:

  • Dimer formation: Many membrane transporters from Arabidopsis, including recombinant proteins like threonine synthase, function as dimers. The C-terminal region often contributes to dimer formation and stability .

  • Conformational changes: Oligomerization likely influences the conformational changes required for bidirectional transport, where monomers may exhibit different transport properties than dimers.

  • Regulatory implications: The oligomeric state may be subject to regulation, affecting transport rates under different physiological conditions.

To investigate SWEET7's oligomeric state, researchers should consider methods such as gel filtration chromatography, blue native PAGE, or chemical crosslinking followed by mass spectrometry, as these approaches have been successfully applied to other Arabidopsis membrane proteins .

What approaches can be used to study the substrate specificity profile of SWEET7?

Determining SWEET7's substrate specificity requires systematic analysis through several complementary methods:

  • Competition binding assays: Using microscale thermophoresis (MST) with a known labeled substrate and various unlabeled potential substrates can reveal binding preferences .

  • Transport kinetics: Measuring transport rates of different substrates in reconstituted liposomes or expression systems can establish:

    • Substrate range (hexoses, pentoses, disaccharides)

    • Km and Vmax values for each substrate

    • Inhibition patterns

  • Structure-guided mutagenesis: Based on sequence analysis and structural predictions, targeted mutations of putative substrate-binding residues can validate the transport mechanism.

  • Comparative analysis: Contrasting SWEET7's specificity with other SWEET family members, particularly SWEET17 which has been characterized as a fructose facilitator, can provide evolutionary insights into substrate specialization .

This multi-faceted approach would provide a comprehensive substrate specificity profile necessary for understanding SWEET7's physiological role .

How can the bidirectional transport capability of SWEET7 be experimentally verified?

Verifying the bidirectional transport capacity of SWEET7 requires specialized experimental approaches:

  • Counterflow experiments: Preload liposomes containing reconstituted SWEET7 with one sugar concentration, then place them in a buffer with a different sugar concentration or type. Bidirectional transporters will demonstrate exchange in both directions.

  • Electrophysiological measurements: When expressed in oocytes or patch-clamped cells, bidirectional transporters like SWEET7 should demonstrate currents in both directions depending on substrate gradients, similar to the approach used for AtENT7 .

  • Fluorescence-based assays: Using fluorescent sugar analogs and quenching techniques can provide real-time visualization of bidirectional transport.

  • Trans-stimulation assays: The presence of substrate on one side of the membrane should stimulate transport in both directions for a truly bidirectional transporter.

These methods collectively establish whether SWEET7 functions as a true bidirectional uniporter facilitating diffusion along concentration gradients, rather than as a concentrative transporter like many other plant ENTs despite their nomenclature as "equilibrative" .

What regulatory mechanisms control SWEET7 activity at the molecular level?

While specific regulatory mechanisms for SWEET7 have not been fully characterized, insights from related transporters suggest several potential regulation pathways:

  • Allosteric regulation: Related transporters like threonine synthase from Arabidopsis are regulated by metabolites; for example, S-adenosyl-L-methionine (SAM) increases activity up to 85-fold. SWEET7 may similarly respond to metabolic indicators .

  • Post-translational modifications: Phosphorylation sites predicted within the SWEET7 sequence may regulate transport activity or membrane localization in response to environmental signals.

  • N-terminal regulation: The N-terminal region often serves regulatory functions in Arabidopsis transporters, as seen in threonine synthase where this region is essential for regulatory properties .

  • Protein-protein interactions: Interactions with regulatory proteins may modulate SWEET7 activity in response to cellular needs.

Investigating these mechanisms requires approaches such as site-directed mutagenesis, phosphoproteomic analysis, and protein interaction studies to establish the regulatory network controlling SWEET7 activity .

How does SWEET7 contribute to drought tolerance mechanisms in Arabidopsis thaliana?

While direct evidence for SWEET7's role in drought tolerance is limited, insights from related SWEET transporters suggest potential mechanisms:

  • Carbohydrate redistribution: SWEET transporters like SWEET17 play crucial roles in sugar mobilization during drought stress. SWEET7 may similarly facilitate sugar transport to water-stressed tissues .

  • Osmotic adjustment: By transporting sugars between cellular compartments or tissues, SWEET7 could contribute to osmotic adjustment, helping maintain turgor under water-limited conditions.

  • Energy allocation: During drought, efficient carbohydrate distribution becomes critical for plant survival. SWEET7 may participate in redirecting energy resources to essential processes .

  • Reproductive success: SWEET17 influences branch elongation and reproduction under drought. SWEET7 might play a complementary role in reproductive tissue development during stress .

Research approaches should include phenotypic analysis of sweet7 mutants under drought conditions, tissue-specific expression studies during water stress, and sugar profiling across tissues to establish SWEET7's contribution to drought resilience .

What are the implications of recombination patterns on SWEET7 genetic diversity in natural Arabidopsis populations?

The genetic diversity of SWEET7 in natural populations is influenced by recombination patterns during hybridization events:

  • Limited recombination events: Studies of F2 Arabidopsis populations reveal most plants carry only one or two crossovers per chromosome pair, resulting in large, non-recombined genomic fragments from each parent. This pattern likely applies to the SWEET7 locus as well .

  • Centromere-adjacent recombination: Recombination frequencies consistently increase near centromeres in Arabidopsis. The chromosomal location of SWEET7 (At4g10850) would influence its recombination frequency and thus genetic diversity .

  • Population-specific variation: Recombination frequencies vary between populations but don't correlate with whole-genome sequence differences between accessions, suggesting other factors control recombination patterns .

  • Functional constraints: As a membrane transporter with essential functions, SWEET7 likely experiences selective pressures that interact with recombination patterns to shape diversity.

Understanding these patterns is crucial for interpreting SWEET7 haplotype distribution in natural Arabidopsis populations and for designing crossing strategies in research settings .

What strategies can overcome expression and purification challenges for recombinant SWEET7?

Membrane proteins like SWEET7 present significant challenges for recombinant expression and purification. Based on successful approaches with similar proteins, researchers should consider:

  • Fusion tags optimization:

    • C-terminal eGFP fusions have proven successful for other Arabidopsis transporters

    • His-tags positioned at the terminus least likely to interfere with function

    • Cleavable tags that can be removed after purification

  • Expression optimization:

    • Temperature reduction during induction (16-22°C)

    • Controlled induction parameters (inducer concentration, cell density)

    • Specialized expression hosts (like P. pastoris) that have succeeded with similar transporters

  • Purification enhancements:

    • Fluorescence-coupled size exclusion chromatography (FSEC) for monitoring protein quality

    • Detergent screening to identify optimal solubilization conditions

    • Addition of lipids or cholesterol analogs to stabilize the protein

  • Quality assessment:

    • Microscale thermophoresis to verify proper folding through substrate binding

    • Circular dichroism to confirm secondary structure elements

This systematic approach has yielded milligram quantities of properly folded membrane transporters from Arabidopsis, as demonstrated with AtENT7 .

How can researchers address segregation distortion when studying SWEET7 function in hybrid Arabidopsis populations?

When studying SWEET7 function in hybrid populations, segregation distortion can complicate genetic analysis. Based on studies of F2 Arabidopsis populations, researchers should implement these strategies:

  • Large population sizing: Sample sizes of several hundred individuals are necessary to detect and account for segregation distortion, which occurs in over half of Arabidopsis F2 populations .

  • Control for seed dormancy: Variation in seed dormancy can cause apparent segregation distortion, requiring synchronized germination protocols or stratification treatments.

  • Lethal epistatic interactions: SWEET7 may participate in epistatic interactions causing segregation distortion. Complementation tests or specific genetic backgrounds can mitigate these effects .

  • Molecular marker density: Using multiple markers flanking the SWEET7 locus helps distinguish true segregation distortion from sampling errors.

  • Statistical adjustments: Specialized statistical models can account for segregation distortion when mapping SWEET7-associated phenotypes in segregating populations.

These approaches are essential for reliable genetic analysis of SWEET7 function in hybrid populations, particularly when phenotyping for complex traits like drought tolerance where multiple genes interact .

How can structural biology approaches advance our understanding of SWEET7 transport mechanisms?

Structural biology offers powerful approaches to elucidate SWEET7's transport mechanism:

  • X-ray crystallography: Following the successful crystallization of recombinant threonine synthase from Arabidopsis, similar approaches could be applied to SWEET7. The sitting drop vapor diffusion method with optimal precipitants might yield diffracting crystals .

  • Cryo-electron microscopy: This technique has revolutionized membrane protein structural biology and could capture SWEET7 in different conformational states during the transport cycle.

  • Molecular dynamics simulations: Based on structural data, simulations can reveal sugar recognition, binding pocket dynamics, and conformational changes during transport.

  • Structure-guided mutagenesis: Strategic mutations based on structural data can validate the transport mechanism and substrate specificity determinants.

A structural biology approach would significantly advance understanding of how SWEET7 accomplishes bidirectional sugar transport and how this mechanism differs from other transporters in Arabidopsis .

What are the potential applications of SWEET7 engineering for improving crop stress resilience?

Engineering SWEET7 or its homologs in crops presents opportunities for enhancing stress resilience:

  • Drought tolerance enhancement: Given the relationship between SWEET transporters and drought response, modifying SWEET7 expression or regulation could improve water-use efficiency in crops .

  • Carbon partitioning optimization: Engineering SWEET7 to alter sugar distribution patterns could enhance carbon allocation to harvested tissues or stress-resistant structures.

  • Pathogen resistance: Some SWEET transporters are targeted by pathogens to manipulate host sugar distribution. Engineering pathogen-resistant variants could improve disease resistance.

  • Reproductive success under stress: Based on findings that SWEET17 influences branching and reproduction during drought, SWEET7 engineering could potentially maintain yield stability under adverse conditions .

Research approaches should include:

  • CRISPR-Cas9 modification of endogenous SWEET genes

  • Heterologous expression of engineered SWEET7 variants

  • Field testing under diverse environmental stresses

  • Metabolomic analysis to confirm altered sugar distribution patterns

These applications represent promising avenues for translating fundamental SWEET7 research into agricultural improvements for climate resilience .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.