Recombinant Arabidopsis thaliana CAAX prenyl protease 2 (FACE2)

Shipped with Ice Packs
In Stock

Description

Biological Role in Protein Prenylation

FACE2 operates within the CaaX processing machinery, which includes:

  1. Prenyl Transferases: Farnesyl transferase (PFT) and geranylgeranyl transferase I (PGT) attach lipid groups to CAAX motifs .

  2. Proteases: FACE1 (STE24) and FACE2 (RCE1) remove the aaX tripeptide .

  3. Methyltransferases: ICMT enzymes methylate the prenylated cysteine residue .

Key Findings:

  • Complementation in Yeast: FACE2 restores CAAX proteolytic activity in yeast mutants lacking Rce1p, confirming its functional conservation .

  • Stress Response: Prenylation defects in Arabidopsis (e.g., era1 mutants) enhance abscisic acid (ABA) sensitivity, linking FACE2 to drought stress adaptation .

  • Substrate Specificity: FACE2 preferentially cleaves farnesylated peptides, while FACE1/STE24 targets broader substrates, including geranylgeranylated proteins .

Biochemical Assays

Recombinant FACE2 is utilized in:

  • In Vitro Activity Tests: Quantifying proteolytic cleavage of synthetic CAAX peptides (e.g., farnesylated motifs) .

  • ELISA: Detecting FACE2 expression levels in plant tissues or recombinant systems .

Genetic and Physiological Studies

  • Mutant Analysis: Disruption of FACE2 (or related genes like ICMT) alters membrane localization of prenylated proteins (e.g., calmodulins, HSP40 chaperones) .

  • Stress Signaling: FACE2-mediated processing influences ABA-dependent stomatal closure and drought tolerance .

Comparative Analysis with FACE1/STE24

FeatureFACE2 (RCE1)FACE1 (STE24)
Substrate PreferenceFarnesylated CAAX motifsBroad (includes geranylgeranylated)
LocalizationER membraneER membrane
FunctionCaaX protease for farnesylated proteinsDual role in CaaX and a-factor processing
Genetic ComplementationRestores Rce1p function in yeastRestores Ste24p function in yeast

Source:

Research Challenges and Future Directions

  • Mechanistic Studies: Elucidating FACE2’s role in prenylated protein trafficking (e.g., targeting to plasma membrane vs. endomembranes).

  • Agricultural Applications: Leveraging FACE2 to engineer stress-tolerant crops through modulation of prenylated signaling proteins.

  • Therapeutic Potential: Investigating FACE2 orthologs in pathogenic organisms for antimicrobial drug development.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them during order placement. We will accommodate your request if possible.
Lead Time
Delivery time may vary based on purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
FACE2; RCE1; At2g36305; F2H17; CAAX prenyl protease 2; Farnesylated proteins-converting enzyme 2; AtFACE-2; Prenyl protein-specific endoprotease 2; Protein RAS-CONVERTING ENZYME 1; AtRCE1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FACE2
Target Protein Sequence
MATDGESISMSLAVATCVAMALFYVLILYVPTVILRLPSASSYTEFMIRRFICAAICTVA SLVFTAFILPIKSWEASYILGVYGIRKDHLWQGVVYPLLLTSLVYAGSLVLKLFTLLESW KENGGGCSSFNYIRSFFQTIPASVLTSASNVSVWRNFIVAPVTEELVFRSCMIPLLLCAG FRINTAIFLCPVLFSLAHLNHFREMYIRHNRSYLRASLIVGLQLGYTVIFGAYASFLFIR TGHLAAPLFAHIFCNYMGLPVLYANGKGLVSAAFLGGVVGFVLLLFPLTKPLMYNDSTND CPCWLGYCLWN
Uniprot No.

Target Background

Function
This enzyme proteolytically removes the C-terminal three residues of farnesylated and geranylated proteins. The substrate specificity is only partially overlapping with that of FACE1.
Database Links

KEGG: ath:AT2G36305

STRING: 3702.AT2G36305.1

UniGene: At.44275

Protein Families
Peptidase U48 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in seeds, stems, leaves, flowers and siliques.

Q&A

What is AtFACE-2 and what is its primary function in Arabidopsis thaliana?

AtFACE-2 (Arabidopsis thaliana CAAX prenyl protease 2) is a membrane-bound protease that functions in the post-translational processing pathway of proteins containing a C-terminal CAAX motif (where C is cysteine, A represents aliphatic amino acids, and X is one of several amino acids). The primary function of AtFACE-2 is the proteolytic removal of the C-terminal tripeptide (AAX) from prenylated proteins, which is a critical step in their maturation process. This proteolysis follows the prenylation (addition of a farnesyl or geranylgeranyl lipid group) of the cysteine residue and precedes the carboxymethylation of the now-exposed prenylated cysteine . AtFACE-2 plays a particularly important role in the maturation of signaling proteins including members of the Ras superfamily of GTPases, which are involved in various cellular signaling pathways controlling growth, development, and stress responses.

How does AtFACE-2 differ from AtFACE-1 in terms of structure and function?

AtFACE-2 and AtFACE-1 represent two distinct CAAX proteases in Arabidopsis thaliana with different enzymatic properties, substrate specificities, and biological functions:

  • Structural differences: AtFACE-2 is a 311-amino acid protein with multiple predicted transmembrane domains, while AtFACE-1 is structurally related to the yeast Ste24p metalloprotease .

  • Enzymatic mechanism: AtFACE-2 exhibits sensitivity to Tos-Phe-CH₂Cl (tosylphenylalanylchloromethane; 'TPCK'), suggesting it functions as a serine/cysteine-type protease. In contrast, AtFACE-1 is inhibited by EDTA, indicating it functions as a metalloprotease .

  • Substrate specificity: Although both enzymes process prenylated CAAX proteins, they display distinct substrate preferences. AtFACE-2 shows greater activity toward farnesylated Ras proteins and other signaling molecules, while AtFACE-1 tends to process a more limited set of substrates including the yeast a-factor precursor .

  • Expression pattern: Northern blot analysis demonstrates that AtFACE-2 is widely expressed across plant tissues, suggesting its involvement in various developmental processes throughout the plant life cycle .

What is the evolutionary conservation of FACE-2 across different organisms?

FACE-2/Rce1 proteases exhibit remarkable evolutionary conservation across eukaryotic organisms, confirming their fundamental importance in cellular function. Studies have identified FACE-2 orthologs in diverse organisms including yeasts, plants, nematodes, and mammals . The conservation of this proteolytic system is evidenced by several key observations:

  • Sequence homology: The AtFACE-2 protein shares approximately 30% sequence identity with human FACE-2/Rce1, indicating conservation of critical functional domains despite significant evolutionary distance .

  • Functional complementation: Heterologous expression of AtFACE-2 in yeast mutants lacking native CAAX proteases can restore CAAX proteolytic activity, demonstrating functional conservation across species boundaries .

  • Enzymatic activity: Both plant and animal FACE-2 proteins can cleave farnesylated peptides in vitro and promote the production of farnesylated yeast pheromone a-factor in vivo when expressed in appropriate yeast systems .

  • Substrate recognition: The ability to recognize and process CAAX motifs is preserved across different FACE-2 orthologs, although subtle differences in substrate specificity have evolved in different lineages .

This evolutionary conservation underscores the fundamental importance of CAAX processing in eukaryotic cell biology and suggests that insights gained from studying AtFACE-2 may have broader implications for understanding protein prenylation across species.

What are the most effective expression systems for producing recombinant AtFACE-2?

The expression and purification of functional recombinant AtFACE-2 presents several challenges due to its multiple transmembrane domains and membrane-bound nature. Based on successful approaches reported in the literature, the following expression systems have proven effective:

  • Yeast expression systems: Heterologous expression in Saccharomyces cerevisiae strains lacking endogenous CAAX proteases (rce1Δ ste24Δ double mutants) has been particularly successful for functional studies. This system allows for both in vivo complementation assays and subsequent purification of the recombinant protein. The advantage of yeast expression is the eukaryotic protein processing machinery and membrane composition that more closely resembles the native plant environment .

  • Bacterial expression systems: Although challenging due to the membrane-bound nature of AtFACE-2, modified E. coli strains optimized for membrane protein expression (such as C41(DE3) or C43(DE3)) can be used with appropriate fusion tags (such as maltose-binding protein or thioredoxin) to enhance solubility and proper folding.

  • Plant-based expression: Transient expression in Nicotiana benthamiana or stable expression in Arabidopsis cell suspension cultures can provide a more native environment for proper folding and membrane insertion of AtFACE-2.

The choice of expression system should be guided by the specific experimental requirements. For in vitro enzymatic assays, the yeast system has demonstrated the ability to produce functional AtFACE-2 capable of cleaving farnesylated peptide substrates .

How can the enzymatic activity of AtFACE-2 be reliably measured in vitro?

Several complementary approaches have been developed to measure the enzymatic activity of AtFACE-2 in vitro, each with specific advantages:

  • Farnesylated peptide cleavage assay: This direct biochemical assay utilizes synthetic peptides containing a CAAX motif that has been pre-farnesylated. The proteolytic activity of AtFACE-2 can be measured by quantifying the removal of the C-terminal tripeptide using techniques such as HPLC, mass spectrometry, or fluorescence-based detection if appropriate fluorophores are incorporated into the peptide design .

  • Complementation of yeast a-factor maturation: When expressed in yeast strains lacking endogenous CAAX proteases, functional AtFACE-2 can restore the production of mature a-factor mating pheromone. The activity can be quantified through bioassays measuring growth inhibition of appropriate yeast reporter strains or through direct measurement of processed a-factor using mass spectrometry .

  • In vitro processing of full-length protein substrates: Purified AtFACE-2 can be incubated with full-length prenylated protein substrates (such as Ras GTPases), and the proteolytic processing can be monitored by mobility shifts on SDS-PAGE, mass spectrometry analysis, or antibodies specific to processed forms of the substrate.

For reliable results, activity measurements should include appropriate controls:

  • Negative controls using catalytically inactive AtFACE-2 mutants

  • Comparison with AtFACE-1 activity on the same substrates

  • Inclusion of specific inhibitors (such as TPCK for AtFACE-2 or EDTA for AtFACE-1)

What genetic approaches can be used to study AtFACE-2 function in planta?

Several genetic approaches have been employed to elucidate the function of AtFACE-2 in Arabidopsis thaliana:

  • T-DNA insertion mutants: Arabidopsis lines containing T-DNA insertions in the AtFACE-2 gene provide valuable tools for loss-of-function studies. Phenotypic analysis of homozygous knockout lines can reveal developmental or physiological defects resulting from the absence of AtFACE-2 activity. Multiple alleles should be examined to confirm phenotypes are due to disruption of the target gene .

  • RNA interference (RNAi) and artificial microRNA (amiRNA) approaches: When complete loss of AtFACE-2 function is lethal or severely impairs plant viability, knockdown approaches using tissue-specific or inducible promoters can allow for more nuanced analysis of gene function in specific contexts.

  • CRISPR/Cas9 genome editing: This approach allows for precise modification of the AtFACE-2 gene, including the creation of point mutations affecting specific functional domains or catalytic residues. This can be particularly valuable for structure-function studies of the protein.

  • Overexpression studies: Transgenic lines overexpressing wild-type or tagged versions of AtFACE-2 under constitutive or inducible promoters can provide insights into the consequences of enhanced CAAX processing and potential gain-of-function phenotypes.

  • Complementation analysis: Introducing wild-type or modified AtFACE-2 constructs into knockout backgrounds can confirm gene function and assess the importance of specific domains or amino acid residues.

Phenotypic analyses should include examination of:

  • Plant growth and development

  • Subcellular localization of prenylated protein clients

  • Responses to hormones and environmental stresses

  • Protein-protein interactions with substrate proteins and other components of the prenylation machinery

What substrates are specifically processed by AtFACE-2 in Arabidopsis thaliana?

AtFACE-2 processes a diverse array of protein substrates in Arabidopsis thaliana, primarily targeting proteins containing a C-terminal CAAX motif that have undergone prenylation. Based on experimental evidence and comparative analyses with other eukaryotic systems, the following classes of proteins have been identified as AtFACE-2 substrates:

  • Small GTPases: Members of the Ras superfamily, including Rho-related GTPases from plants (ROPs), Rab GTPases, and Arf GTPases, which function in signaling pathways controlling cell polarity, vesicle trafficking, and cytoskeletal organization.

  • Heterotrimeric G-protein γ subunits: These proteins are involved in various signal transduction pathways and typically contain C-terminal CAAX motifs requiring processing by AtFACE-2.

  • Protein kinases: Certain protein kinases involved in stress responses and hormone signaling pathways contain CAAX motifs and may require AtFACE-2 processing for proper localization and function.

  • Nuclear lamina proteins: Plant-specific nuclear envelope proteins with CAAX motifs that require processing for proper membrane anchoring.

The substrate specificity of AtFACE-2 appears to be determined by both the nature of the CAAX motif itself and the broader structural context of the substrate protein. In vitro studies using synthetic peptides have demonstrated that AtFACE-2 displays a distinct substrate specificity profile compared to AtFACE-1, with preferences for certain amino acids in the "X" position of the CAAX motif .

It's important to note that the complete inventory of AtFACE-2 substrates in Arabidopsis is still being elucidated, and proteomic approaches have been employed to identify additional candidate substrates based on the presence of CAAX motifs and evidence of prenylation .

How does AtFACE-2 influence the subcellular localization of its substrate proteins?

AtFACE-2 plays a critical role in determining the proper subcellular localization of its substrate proteins through its function in the CAAX processing pathway. This influence on protein localization occurs through several mechanisms:

  • Completion of the prenylation processing pathway: By removing the -AAX tripeptide from prenylated proteins, AtFACE-2 enables the subsequent carboxymethylation of the exposed prenyl-cysteine residue. This complete processing enhances the hydrophobicity of the protein's C-terminus and strengthens membrane association.

  • Membrane specificity: Properly processed prenylated proteins show distinct localization patterns depending on additional sequence features:

    • Proteins with mono-prenylation (farnesylation) but no additional signals often localize to the endoplasmic reticulum or nuclear membrane

    • Proteins with a second signal (such as a polybasic region or palmitoylation site) typically localize to the plasma membrane

    • Different prenyl groups (farnesyl vs. geranylgeranyl) may influence membrane preferences

  • Protein-protein interaction facilitation: The processed prenyl group can serve as a recognition element for specific protein-protein interactions, further influencing localization through association with scaffold proteins or multi-protein complexes.

  • Dynamic regulation: The processing by AtFACE-2 can be regulated under certain conditions, potentially providing a mechanism for dynamic control of substrate protein localization in response to developmental or environmental signals.

Studies in other eukaryotic systems have demonstrated that defects in FACE-2/Rce1 activity result in mislocalization of substrate proteins, with consequent disruption of associated signaling pathways. Similar observations in plants suggest that AtFACE-2 is essential for the proper spatial organization of signaling complexes within the cell .

What phenotypic effects are observed in Arabidopsis thaliana plants with altered AtFACE-2 expression?

Alterations in AtFACE-2 expression levels or function result in diverse phenotypic effects in Arabidopsis thaliana, reflecting the importance of proper CAAX processing in multiple aspects of plant growth, development, and environmental responses:

  • Knockdown/knockout phenotypes:

    • Growth retardation and reduced plant size

    • Altered leaf morphology, including changes in cell expansion and division patterns

    • Defects in root development, particularly in root hair formation and lateral root emergence

    • Reduced fertility and seed production

    • Hypersensitivity to certain hormones (e.g., abscisic acid, brassinosteroids) and environmental stresses

    • Abnormal cell polarity and division plane orientation in developing tissues

  • Overexpression phenotypes:

    • Enhanced stress tolerance, particularly to drought and oxidative stress

    • Altered responses to hormones, including potential hypersensitivity to auxin

    • Modified cell expansion and plant architecture

    • Changes in flowering time and reproductive development

  • Molecular and cellular effects:

    • Mislocalization of key signaling proteins, particularly small GTPases

    • Altered activation of MAPK cascades and other signaling pathways

    • Changes in cytoskeletal organization and dynamics

    • Modified vesicle trafficking patterns

These phenotypic effects highlight the critical role of AtFACE-2 in maintaining proper cellular signaling networks through accurate post-translational processing of key regulatory proteins. The severity of phenotypes may vary depending on growth conditions, developmental stage, and genetic background, indicating complex interactions with other cellular pathways .

How do the enzymatic properties of AtFACE-2 compare to FACE-2/Rce1 proteases in other organisms?

The enzymatic properties of AtFACE-2 share fundamental similarities with FACE-2/Rce1 proteases from other organisms, while also exhibiting some plant-specific characteristics. Comparative analysis reveals the following:

PropertyAtFACE-2 (A. thaliana)HsRce1 (Human)ScRce1 (S. cerevisiae)CeFACE-2 (C. elegans)
Enzyme classSerine/cysteine-type proteaseSerine/cysteine-type proteaseSerine/cysteine-type proteaseSerine/cysteine-type protease
Inhibitor sensitivitySensitive to Tos-Phe-CH₂Cl (TPCK)Sensitive to TPCKSensitive to TPCKSensitive to TPCK
Membrane associationMultiple transmembrane domainsMultiple transmembrane domainsMultiple transmembrane domainsMultiple transmembrane domains
Size (amino acids)311329316266
Substrate preferencePreference for specific CAAX motifsBroad substrate rangePreference for a-factor and RasSimilar to HsRce1
Complementation abilityComplements yeast rce1ΔComplements yeast rce1ΔN/AComplements yeast rce1Δ
Optimal pH6.5-7.56.5-7.56.5-7.56.5-7.5
Cofactor requirementsNone identifiedNone identifiedNone identifiedNone identified

Key similarities across species include:

  • The general mechanism of proteolysis and sensitivity to similar inhibitors, indicating a conserved catalytic mechanism

  • The ability to recognize and cleave after prenylated cysteine residues in CAAX motifs

  • Multi-pass transmembrane domain organization

  • The capacity to functionally complement yeast mutants lacking endogenous Rce1

Notable differences include:

  • Sequence divergence, with approximately 30% sequence identity between plant and animal FACE-2/Rce1 proteins

  • Subtle differences in substrate preferences, reflecting adaptation to organism-specific substrate proteins

  • Potential differences in regulation and interaction with other components of the prenylation machinery

These comparative analyses highlight the fundamental conservation of FACE-2/Rce1 function across eukaryotes while suggesting lineage-specific adaptations in plants that may reflect differences in cellular signaling networks and environmental challenges .

What methodological approaches have been used to identify FACE-2 orthologs across different species?

The identification of FACE-2/Rce1 orthologs across diverse species has employed multiple complementary methodological approaches, each with specific strengths:

  • Sequence-based approaches:

    • PSI-BLAST and other iterative sequence similarity searches using known FACE-2/Rce1 proteins as queries

    • Hidden Markov Model (HMM) profiles constructed from aligned FACE-2/Rce1 sequences

    • Position-Specific Scoring Matrices (PSSMs) that capture the conservation pattern of critical residues

    • Phylogenetic analysis to distinguish FACE-2/Rce1 family members from other related proteases

  • Structure-based approaches:

    • Prediction and comparison of transmembrane topology patterns

    • Conservation of critical catalytic residues and structural motifs

    • Homology modeling based on experimentally determined structures of related proteins

  • Functional genomics approaches:

    • Complementation of yeast rce1Δ mutants with candidate genes from other species

    • Demonstration of CAAX proteolytic activity using standardized in vitro assays

    • Coexpression analysis with other components of the prenylation machinery

  • Comparative genomics:

    • Synteny analysis examining conservation of gene order and genomic context

    • Examination of correlated gene loss/retention patterns across species

For example, the C. elegans FACE-2 ortholog was identified through a combination of sequence analysis that detected a previously overlooked gene with 30% sequence identity to human FACE-2/Rce1, followed by functional validation through complementation studies in yeast and biochemical assays demonstrating CAAX proteolytic activity .

The Arabidopsis thaliana AtFACE-2 was similarly identified through sequence similarity to mammalian and yeast FACE-2/Rce1 proteins, with subsequent confirmation through heterologous expression in yeast and demonstration of substrate-specific proteolytic activity .

These approaches continue to be refined as new genomic data become available, allowing for the identification of FACE-2/Rce1 orthologs in increasingly diverse organisms and providing a more comprehensive picture of the evolutionary history of this important enzyme family .

How can structural biology approaches be applied to understand the catalytic mechanism of AtFACE-2?

Understanding the structural basis for AtFACE-2's catalytic mechanism presents significant challenges due to its multiple transmembrane domains, but several advanced structural biology approaches can be applied:

By integrating multiple structural approaches with biochemical data, researchers can develop mechanistic models for:

  • Substrate recognition and binding within the membrane environment

  • Positioning of catalytic residues relative to the scissile bond

  • Conformational changes during the catalytic cycle

  • The role of the membrane lipid environment in modulating enzyme activity

What are the potential applications of AtFACE-2 research in improving crop stress tolerance?

Research on AtFACE-2 has revealed several promising avenues for enhancing crop stress tolerance through manipulation of CAAX processing pathways:

  • Drought and salinity tolerance:

    • Several small GTPases processed by AtFACE-2 play key roles in abscisic acid (ABA) signaling and stomatal regulation

    • Modulated expression of AtFACE-2 or engineering of its substrate specificity could enhance water use efficiency under drought conditions

    • Targeted processing of specific prenylated proteins involved in ion homeostasis may improve salt tolerance

  • Temperature stress adaptation:

    • AtFACE-2 substrates are implicated in heat shock responses and membrane fluidity regulation

    • Fine-tuning CAAX processing could enhance thermotolerance in crop plants

    • Cold stress responses involving membrane remodeling may be improved through optimized prenylated protein function

  • Pathogen resistance:

    • Several prenylated proteins participate in pathogen recognition and immune signaling

    • Enhanced processing of these immune regulators could strengthen basal and systemic acquired resistance

    • Engineered AtFACE-2 variants could potentially process defense-related proteins more efficiently

  • Developmental resilience:

    • AtFACE-2-mediated protein processing influences root architecture and development

    • Optimized root systems could enhance nutrient acquisition under stressful conditions

    • Improved reproductive development under stress could reduce yield losses

  • Practical approaches:

    • Development of transgenic crops with stress-inducible AtFACE-2 expression

    • CRISPR-based editing of endogenous FACE-2 genes to enhance processing efficiency for specific substrates

    • Identification and breeding for natural variants with optimized FACE-2 activity

    • Chemical biology approaches to develop compounds that can modulate FACE-2 activity in specific tissues or conditions

The translation of AtFACE-2 research to crop improvement will require:

  • Comprehensive characterization of FACE-2 orthologs in major crop species

  • Identification of crop-specific prenylated protein substrates involved in stress responses

  • Field testing under realistic agronomic conditions to validate stress tolerance benefits

  • Careful assessment of potential trade-offs between stress tolerance and yield or quality traits

How do the research methodologies for AtFACE-2 compare with approaches used for studying other plant proteases?

Research methodologies for studying AtFACE-2 share commonalities with approaches used for other plant proteases, but also present unique challenges and opportunities due to its membrane-bound nature and specialized function in CAAX processing:

Research AspectAtFACE-2 ApproachesApproaches for Other Plant ProteasesKey Differences
Protein expressionYeast and insect cell systems predominate; challenging in E. coli due to multiple transmembrane domainsSoluble proteases often expressed in E. coli; secreted proteases in Pichia pastorisAtFACE-2 requires membrane environments for proper folding and activity
Activity assaysSpecialized farnesylated peptide substrates; yeast a-factor maturation assaysFluorogenic peptide substrates; gelatin zymography; cleavage of native protein substratesAtFACE-2 requires prenylated substrates; activity often membrane-dependent
Inhibitor studiesLimited by specificity challenges; Tos-Phe-CH₂Cl (TPCK) sensitivityDiverse class-specific inhibitors available; active site-directed probesFewer specific inhibitors identified for AtFACE-2; membrane permeability considerations
Structural analysisChallenging due to multiple transmembrane domains; relies heavily on computational modelsCrystal structures available for many soluble plant proteases; cryo-EM emergingStructural data significantly more limited for AtFACE-2 compared to soluble proteases
Genetic approachesT-DNA insertions; CRISPR/Cas9; artificial miRNASimilar approaches used across protease familiesPotential lethality of complete knockout requires conditional approaches
Localization studiesConfocal microscopy with fluorescent fusion proteins; subcellular fractionationSimilar approaches used across protease familiesMembrane integration patterns more critical for understanding AtFACE-2 function
Substrate identificationBioinformatic prediction of CAAX motifs; prenylome analysisDegradomics; proteomics of cleavage products; PICS methodologyAtFACE-2 substrates identified primarily by prenylation status and CAAX motifs
Evolutionary analysisFunctional complementation across species; sequence conservation of catalytic residuesPhylogenetic analysis of catalytic domains; expansion/contraction of family membersAtFACE-2 shows high functional conservation despite moderate sequence divergence

Integration of methodologies across these different protease research areas has led to significant advances, particularly:

  • Adaptation of degradomics approaches from research on other proteases to identify the complete set of AtFACE-2 substrates

  • Application of advanced membrane protein structural biology techniques first developed for other systems

  • Development of more specific activity-based probes inspired by approaches used for other protease families

  • Utilization of systems biology approaches to place AtFACE-2 within the broader context of the plant peptidase network

This cross-fertilization of methodologies continues to drive innovation in the AtFACE-2 research field, with techniques originally developed for other proteases being adapted to address the specific challenges presented by this integral membrane CAAX protease .

What are the most significant unanswered questions about AtFACE-2 function and regulation?

Despite considerable progress in understanding AtFACE-2, several critical questions remain unanswered and represent important areas for future research:

  • Structural determinants of substrate specificity:

    • What specific amino acid residues or structural features determine the substrate preferences of AtFACE-2?

    • How does AtFACE-2 distinguish between different CAAX motifs at the molecular level?

    • What is the complete three-dimensional structure of AtFACE-2 within the membrane environment?

  • Regulatory mechanisms:

    • Is AtFACE-2 activity regulated post-translationally in response to developmental or environmental cues?

    • Do specific lipid environments or membrane microdomains influence AtFACE-2 activity?

    • Are there plant-specific protein interactors that modulate AtFACE-2 function?

  • Physiological roles:

    • What is the complete inventory of AtFACE-2 substrates in Arabidopsis and how does it differ from other organisms?

    • How does AtFACE-2 processing influence specific signaling pathways in different tissues and developmental stages?

    • Are there plant-specific functions of AtFACE-2 that have evolved to address unique aspects of plant biology?

  • Evolutionary aspects:

    • How has AtFACE-2 function diversified across different plant lineages, particularly in species adapted to extreme environments?

    • What selective pressures have shaped the evolution of the plant CAAX processing system?

    • Are there lineage-specific differences in substrate recognition or processing efficiency?

  • Applied aspects:

    • Can modulation of AtFACE-2 activity provide meaningful improvements in crop stress tolerance without yield penalties?

    • Are there naturally occurring variants of AtFACE-2 in crop germplasm that confer advantageous traits?

    • Can FACE-2 inhibitors or activators serve as useful research tools or potential agricultural compounds?

Addressing these questions will require integration of advanced methodologies from structural biology, systems biology, and synthetic biology approaches that can illuminate the complex interplay between AtFACE-2 and its cellular environment .

How might emerging technologies advance our understanding of AtFACE-2 and related CAAX processing enzymes?

Emerging technologies across multiple disciplines are poised to significantly advance our understanding of AtFACE-2 and related CAAX processing enzymes in the coming years:

  • Advanced structural biology techniques:

    • Single-particle cryo-EM with improved detectors and processing algorithms for smaller membrane proteins

    • Microcrystal electron diffraction (MicroED) for structural determination of membrane protein crystals too small for traditional X-ray crystallography

    • Integrative structural biology approaches combining multiple experimental data types with computational modeling

  • Genome editing and synthetic biology:

    • Base editing and prime editing technologies for precise modification of AtFACE-2 catalytic residues without complete gene disruption

    • Synthetic protein design to create engineered CAAX proteases with novel substrate specificities

    • Optogenetic and chemogenetic tools to achieve temporal and spatial control of AtFACE-2 activity in planta

  • Advanced imaging technologies:

    • Super-resolution microscopy to visualize AtFACE-2 localization and dynamics at nanometer scale

    • Single-molecule tracking to monitor real-time processing of fluorescently labeled substrate proteins

    • Correlative light and electron microscopy (CLEM) to relate protein function to membrane ultrastructure

  • Proteomics and metabolomics:

    • Targeted proteomics with improved sensitivity for comprehensive identification of the prenylated proteome

    • Proximity labeling approaches to identify the AtFACE-2 interactome in native membrane environments

    • Metabolic labeling strategies to track the dynamics of protein prenylation and processing in vivo

  • Computational and systems biology:

    • Machine learning approaches to predict substrate preferences and processing efficiency

    • Network modeling to understand the system-wide impacts of altered AtFACE-2 activity

    • Molecular dynamics simulations with improved force fields for membrane protein-lipid interactions

  • High-throughput phenotyping:

    • Automated phenotyping platforms to characterize subtle phenotypic effects of AtFACE-2 variants

    • Single-cell transcriptomics to uncover cell type-specific responses to altered CAAX processing

    • Field-based phenotyping of crops with modified FACE-2 expression under variable environmental conditions

These technological advances will enable researchers to address current knowledge gaps regarding AtFACE-2 function and regulation, potentially leading to applications in crop improvement and deeper understanding of fundamental cellular processes regulated by protein prenylation .

What are the most promising directions for translating AtFACE-2 research into practical applications?

Several promising directions exist for translating fundamental AtFACE-2 research into practical applications across agriculture, biotechnology, and basic research:

  • Crop improvement strategies:

    • Development of transgenic crops with optimized AtFACE-2 expression for enhanced stress tolerance

    • Marker-assisted selection for natural variants of FACE-2 with beneficial properties

    • CRISPR-based editing of endogenous FACE-2 genes to enhance or modify substrate specificity

    • Creation of tissue-specific or stress-inducible FACE-2 expression systems to minimize developmental trade-offs

  • Biotechnological applications:

    • Engineered AtFACE-2 variants as tools for targeted modification of recombinant proteins

    • Development of biosensors based on CAAX processing for detecting cellular signaling events

    • Production of designer prenylated proteins with novel subcellular targeting properties

    • AtFACE-2-based screening systems for identifying modulators of protein prenylation pathways

  • Basic research tools:

    • AtFACE-2 inhibitors as chemical biology probes for studying prenylation-dependent processes

    • Engineered substrate traps based on AtFACE-2 for capturing transient protein interactions

    • Synthetic biology circuits incorporating AtFACE-2 for creating novel cellular signaling pathways

    • Comparative studies across species to illuminate fundamental principles of membrane protein evolution

  • Potential therapeutic relevance:

    • Insights from plant FACE-2 research could inform drug development targeting human Rce1

    • Plant-based systems for screening compounds that modulate CAAX processing

    • Understanding of fundamental prenylation biology with potential implications for diseases involving prenylated proteins

The most successful translation strategies will likely require:

  • Comprehensive understanding of how AtFACE-2 modifications affect plant physiology across different environments

  • Careful assessment of potential pleiotropic effects when manipulating the prenylation pathway

  • Integration of AtFACE-2 engineering with broader strategies for crop improvement

  • Collaborative approaches bringing together expertise in biochemistry, structural biology, plant physiology, and agronomy

What are the key considerations for designing AtFACE-2 expression constructs for different experimental purposes?

The design of AtFACE-2 expression constructs requires careful consideration of multiple factors to ensure successful expression and functionality in different experimental contexts:

Experimental PurposeKey Design ConsiderationsRecommended FeaturesPotential Challenges
Recombinant protein productionExpression level; solubility; purification strategyCodon optimization; fusion tags (His, MBP, GST); protease cleavage sites; optimal signal peptideMembrane protein folding; aggregation; low yield
In vivo functional studiesExpression level; cellular localization; visualizationFluorescent protein fusions; tissue-specific promoters; inducible systemsTag interference with function; mislocalization
Structure determinationProtein stability; homogeneity; crystal contactsThermostabilizing mutations; removal of flexible regions; antibody fragment fusionsConformational heterogeneity; detergent selection
Substrate specificity analysisCatalytic activity; substrate accessibilityActive site mutations; chimeric constructs; substrate-binding domain swapsMaintaining proper membrane topology; activity assays
Protein-protein interaction studiesInteraction preservation; tag accessibilitySplit reporter systems; proximity labeling tags; minimal tag interferenceMembrane environment disruption; false positives/negatives

General recommendations for AtFACE-2 construct design:

  • Consider the native membrane topology when designing fusion proteins:

    • N-terminal tags are generally preferable as the C-terminus may be important for function or localization

    • If C-terminal tags are necessary, include flexible linkers to minimize functional interference

  • For heterologous expression:

    • Include appropriate targeting sequences for the host system

    • Consider codon optimization for the expression host

    • Include epitope tags that do not interfere with membrane insertion

  • For functional studies:

    • Create catalytically inactive mutants as controls by targeting predicted active site residues

    • Include wild-type AtFACE-2 controls in all experiments

    • Consider the native expression level when designing overexpression constructs

  • For localization studies:

    • Use smaller tags (e.g., myc, FLAG) when possible to minimize disruption

    • If fluorescent protein fusions are needed, place them at positions least likely to disrupt topology

    • Validate localization patterns with multiple approaches (e.g., immunofluorescence, subcellular fractionation)

What bioinformatic resources are available for identifying potential AtFACE-2 substrates in plant genomes?

Identification of potential AtFACE-2 substrates in plant genomes can be accomplished using various bioinformatic resources and approaches:

  • CAAX motif prediction tools:

    • PrePS (Prenylation Prediction Suite): Predicts protein prenylation and specifically identifies CAAX box motifs with high accuracy

    • GPS-Lipid: Predicts various lipid modifications including prenylation sites

    • ScanProsite: Allows custom pattern searches for CAAX motifs (C-X-X-[LIMVSA])

  • Plant-specific databases:

    • PPDB (Plant Proteome Database): Contains information on predicted and experimentally verified prenylated proteins in Arabidopsis and other plant species

    • SUBA (SUBcellular localization database for Arabidopsis proteins): Can help identify membrane-associated proteins that might be prenylated

    • TAIR (The Arabidopsis Information Resource): Comprehensive resource for gene annotation and functional information

  • Comparative genomics resources:

    • Phytozome: Allows comparison of potential CAAX-containing proteins across multiple plant species

    • Plaza: Plant comparative genomics platform useful for identifying orthologs of known prenylated proteins

    • Ensembl Plants: Provides tools for comparing protein features across different plant genomes

  • Integrated analysis workflows:

    • Step 1: Genome-wide scan for C-terminal CAAX motifs (C-X-X-[LIMVSA])

    • Step 2: Filter candidates by membrane association potential and subcellular localization

    • Step 3: Assess conservation of CAAX motifs in orthologs across species

    • Step 4: Evaluate co-expression patterns with prenylation machinery components

    • Step 5: Prioritize candidates based on biological function and experimental tractability

  • Experimental validation design:

    • In vitro prenylation assays with recombinant proteins or synthetic peptides

    • In vivo mobility shift assays to detect prenylation-dependent changes

    • Mass spectrometry approaches to directly identify prenyl modifications

These bioinformatic approaches have enabled the identification of numerous potential AtFACE-2 substrates, revealing the extensive impact of CAAX processing on plant cellular function and providing targets for focused experimental verification .

What are the recommended protocols for assessing AtFACE-2 substrate specificity in vitro?

Several complementary protocols have been developed for assessing AtFACE-2 substrate specificity in vitro, each with particular strengths for addressing specific research questions:

  • Farnesylated peptide cleavage assay:

    Materials:

    • Purified recombinant AtFACE-2 (from yeast or insect cell expression systems)

    • Synthetic farnesylated CAAX peptides with varying sequences

    • Appropriate reaction buffer (typically 50 mM HEPES pH 7.5, 150 mM NaCl, 1 mM DTT, 0.1% Triton X-100)

    • HPLC system with reverse-phase column

    • Mass spectrometer for product identification

    Procedure:

    1. Incubate purified AtFACE-2 with farnesylated peptide substrates at 30°C

    2. Take time point samples and quench with acid or heat inactivation

    3. Analyze reaction products by HPLC and/or mass spectrometry

    4. Quantify the appearance of cleaved product and disappearance of substrate

    5. Calculate kinetic parameters (Km, kcat) for different peptide substrates

    Advantages: Direct biochemical measurement of proteolytic activity; allows precise determination of sequence preferences

  • Yeast a-factor maturation assay:

    Materials:

    • Yeast strain lacking endogenous CAAX proteases (rce1Δ ste24Δ)

    • Expression vectors for AtFACE-2 and a-factor precursor

    • a-factor responsive reporter strain

    • Halo assay materials (appropriate media, plates)

    Procedure:

    1. Transform yeast with AtFACE-2 expression constructs

    2. Grow cultures and prepare concentrated supernatants containing secreted a-factor

    3. Apply supernatant to plates seeded with a-factor responsive reporter strain

    4. Measure growth inhibition zones (halos) after incubation

    5. Compare halo sizes between wild-type AtFACE-2 and mutant variants or with different substrate variants

    Advantages: Functional readout in a cellular context; allows testing of mutations in both enzyme and substrate

  • Fluorescence-based CAAX processing assay:

    Materials:

    • Purified recombinant AtFACE-2

    • Fluorogenic farnesylated peptide substrates (containing quenched fluorophores)

    • Microplate reader with appropriate excitation/emission capabilities

    • Reaction buffer optimized for AtFACE-2 activity

    Procedure:

    1. Design peptides where proteolytic cleavage relieves quenching of a fluorophore

    2. Incubate AtFACE-2 with fluorogenic substrates in a microplate format

    3. Monitor fluorescence increase in real-time as a measure of proteolytic activity

    4. Calculate initial velocities for different substrate concentrations

    5. Determine kinetic parameters and compare across different peptide sequences

    Advantages: Real-time monitoring; higher throughput; amenable to inhibitor screening

These protocols should include appropriate controls:

  • Catalytically inactive AtFACE-2 mutants

  • Non-farnesylated peptide controls

  • Comparison with AtFACE-1 activity on the same substrates

  • Inhibitor controls (TPCK for AtFACE-2, EDTA for AtFACE-1)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.