Recombinant Arabidopsis thaliana Calcium-activated outward-rectifying potassium channel 1 (KCO1)

Shipped with Ice Packs
In Stock

Description

Calcium-Dependent Activation Mechanism

KCO1 activation requires nanomolar cytosolic Ca²⁺ concentrations, distinguishing it from other plant K⁺ channels :

ParameterValueSource
Activation threshold>150 nM [Ca²⁺]cyt
Half-maximal activation~200 nM [Ca²⁺]cyt
Saturation~300 nM [Ca²⁺]cyt

Functional insights:

  • No currents are detected below 150 nM [Ca²⁺]cyt .

  • Single-channel conductance: 64 pS (measured in excised membrane patches) .

Biophysical Properties

Recombinant KCO1 exhibits unique electrophysiological traits when expressed in heterologous systems (e.g., Spodoptera frugiperda insect cells) :

PropertyDescription
RectificationStrong outward rectification (K⁺ efflux favored during depolarization)
Ion selectivityK⁺ > Na⁺ (permeability ratio PK⁺/PNa⁺ > 10:1)
PharmacologyBlocked by Ba²⁺ (IC₅₀ = 3.8 mM)

Recombinant Production and Applications

KCO1 has been heterologously expressed in multiple systems for functional studies :

Host SystemPurityKey Findings
Baculovirus/insect cells≥85%Demonstrated Ca²⁺-dependent activation and outward rectification
E. coli or mammalian cells≥85%Used for antibody production and structural analyses

Applications include:

  • Studying Ca²⁺-K⁺ crosstalk in stomatal regulation and seed germination .

  • Modeling plant vacuolar K⁺ efflux mechanisms .

Research Significance

KCO1’s identification as the first plant outward-rectifying K⁺ channel provided foundational insights into:

  • Evolutionary divergence of two-pore K⁺ channels across eukaryotes .

  • Mechanistic links between calcium signaling and ion transport .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have readily available. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery details.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development
Synonyms
TPK1; KCO1; At5g55630; MDF20.7; Two-pore potassium channel 1; AtTPK1; Calcium-activated outward-rectifying potassium channel 1; AtKCO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-363
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
TPK1
Target Protein Sequence
MSSDAARTPLLPTEKIDTMAQDFNLNSRTSSSRKRRLRRSRSAPRGDCMYNDDVKIDEPP PHPSKIPMFSDLNPNLRRVIMFLALYLTIGTLCFYLVRDQISGHKTSGVVDALYFCIVTM TTVGYGDLVPNSSASRLLACAFVFSGMVLVGHLLSRAADYLVEKQEALLVRAFHLRQSFG PTDILKELHTNKLRYKCYATCLVLVVLFIVGTIFLVMVEKMPVISAFYCVCSTVTTLGYG DKSFNSEAGRLFAVFWILTSSICLAQFFLYVAELNTENKQRALVKWVLTRRITNNDLEAA DLDEDGVVGAAEFIVYKLKEMGKIDEKDISGIMDEFEQLDYDESGTLTTSDIVLAQTTSQ IQR
Uniprot No.

Target Background

Function
This protein serves as a voltage-independent, large conductance potassium-selective tonoplast ion channel. Its activity is regulated by cytoplasmic calcium and pH. It does not mediate slow-vacuolar (SV) ionic currents but is crucial for establishing VK currents. While exhibiting some permeability for Rb(+) and NH(4)(+), it does not permit passage of Na(+), Cs(+) or Li(+). It plays a role in intracellular K(+) redistribution and/or K(+) retranslocation between different tissues.
Gene References Into Functions
  1. ATKCO1 is capable of forming functional potassium transport systems in E. coli PMID: 23656881
  2. TPK1 requires proper assembly to pass endoplasmic reticulum quality control. PMID: 21697507
  3. Research demonstrates that TPK1 (KCO1) functions as a voltage-independent, Ca(2+)-activated, K(+)-selective ion channel within the vacuolar membrane, distinct from SV-type ionic currents [TPK1] PMID: 16113216
  4. The two-pore channel TPK1 gene encodes the vacuolar K+ conductance and plays a role in K+ homeostasis. PMID: 17563365
  5. Findings indicate that AtTPK1 (KCO1) interacts with 14-3-3 proteins (general regulating factors, GRFs). TPK1 seems to provide a Ca(2+)- and 14-3-3-sensitive mechanism for regulating cytoplasmic potassium homeostasis in plants. PMID: 17764516

Show More

Hide All

Database Links

KEGG: ath:AT5G55630

STRING: 3702.AT5G55630.1

UniGene: At.20254

Protein Families
Two pore domain potassium channel (TC 1.A.1.7) family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.
Tissue Specificity
Detected in mesophyll cells, guard cells and vascular tissues of the leaves. Expressed in the hilum, where the funiculus is attached during fruit maturation and in the embryo. Also expressed at a lower level in seedlings, root tips and elongation zones, a

Q&A

What is the physiological role of KCO1 in Arabidopsis thaliana?

KCO1 functions as a calcium-activated outward-rectifying potassium channel in Arabidopsis thaliana, playing crucial roles in maintaining cellular ion homeostasis, particularly during stress responses. Similar to other ion channels in Arabidopsis, such as MSL10 which participates in hypo-osmotic shock adaptation and programmed cell death induction, KCO1 likely contributes to the plant's ability to respond to environmental changes by regulating potassium efflux in a calcium-dependent manner . The channel likely works in concert with other ion transport systems to maintain membrane potential and cellular osmotic balance.

How does KCO1 structure relate to its calcium-activation properties?

KCO1's structural features include calcium-binding domains that undergo conformational changes upon calcium binding, leading to channel activation. While specific structural details of KCO1 are still being investigated, insights from other Arabidopsis ion channels suggest that specific amino acid residues are critical for ion selectivity and gating mechanisms. For example, in AtCLCa (a chloride channel), proline 160 plays an important role in nitrate metabolism . Similarly, KCO1 likely contains key residues that determine its selectivity for potassium ions and sensitivity to calcium.

What expression patterns does KCO1 show across different tissues in Arabidopsis?

KCO1 expression varies across different Arabidopsis tissues, with expression patterns likely influenced by developmental stages and environmental conditions. Similar to other ion channels such as CNGC2, which is expressed in root epidermis, KCO1 expression patterns can be detected through techniques like quantitative real-time PCR . Understanding these expression patterns provides insights into the physiological contexts in which KCO1 functions.

What are the most effective heterologous expression systems for functional characterization of recombinant KCO1?

For functional characterization of recombinant KCO1, several heterologous expression systems have proven effective:

Expression SystemAdvantagesLimitationsBest Applications
Xenopus laevis oocytesLarge cells ideal for electrophysiology, established protocolsRequires specialized equipment, not suitable for high-throughputDetailed electrophysiological characterization
Mammalian cell lines (HEK293, CHO)Human-like post-translational modifications, good for imagingMore expensive, complex transfectionProtein-protein interaction studies, trafficking analysis
Yeast systemsCost-effective, amenable to high-throughput screeningLimited post-translational processingMutational analysis, drug screening

The Xenopus oocyte system has been successfully used for other Arabidopsis ion channels, such as MCA1, where expression enhanced mechanosensitive channel activity in the plasma membrane . Similar approaches can be applied to KCO1 characterization.

How can I optimize the PCR conditions for KCO1 cloning from Arabidopsis genomic DNA?

Optimizing PCR conditions for KCO1 cloning requires careful consideration of several parameters:

  • Template quality: Extract high-quality genomic DNA from young Arabidopsis leaves using a plant DNA extraction kit that effectively removes polysaccharides and secondary metabolites.

  • Primer design: Design primers with the following specifications:

    • 18-25 nucleotides in length

    • GC content between 40-60%

    • Melting temperatures between 55-65°C

    • Add appropriate restriction sites with 3-6 additional nucleotides at the 5' end for subsequent cloning

  • PCR conditions:

    • Initial denaturation: 95°C for 3 minutes

    • 30-35 cycles of:

      • Denaturation: 95°C for 30 seconds

      • Annealing: 58-62°C for 30 seconds (optimize based on primer Tm)

      • Extension: 72°C for 1 minute per kb of target

    • Final extension: 72°C for 10 minutes

  • Use high-fidelity DNA polymerase to minimize mutation introduction

These approaches are similar to those used in studies of other Arabidopsis genes, as seen in genetic analyses of meiotic recombination events .

What are the recommended methods for measuring KCO1 channel activity in Arabidopsis protoplasts?

For measuring KCO1 channel activity in Arabidopsis protoplasts, the following methods are recommended:

  • Patch-clamp electrophysiology: This gold-standard approach allows direct measurement of KCO1-mediated currents. Similar to techniques used for CNGC2 characterization, whole-cell recordings can reveal channel properties including:

    • Voltage dependence

    • Calcium sensitivity

    • Potassium selectivity

    • Activation/inactivation kinetics

  • Calcium imaging: Since KCO1 is calcium-activated, concurrent calcium imaging using fluorescent indicators (e.g., Fura-2, Fluo-4) can provide insights into the relationship between calcium transients and channel activity.

  • Membrane potential measurements: Using voltage-sensitive dyes or electrodes to monitor membrane potential changes in response to stimuli that activate KCO1.

Similar approaches have been successfully applied to other ion channels in Arabidopsis, such as measuring eATP-induced changes in epidermal cell plasma membrane voltage and conductance for CNGC2 .

How do post-translational modifications affect KCO1 function and localization?

Post-translational modifications (PTMs) significantly impact KCO1 function and localization through several mechanisms:

  • Phosphorylation: Key serine/threonine residues likely undergo phosphorylation, affecting:

    • Channel open probability

    • Calcium sensitivity

    • Protein-protein interactions

    • Subcellular trafficking

  • Ubiquitination: Controls channel turnover and degradation, influencing total available functional channels at the membrane.

  • Glycosylation: May affect protein folding, stability, and trafficking to the plasma membrane.

To study these PTMs:

  • Use phospho-specific antibodies for Western blotting

  • Employ mass spectrometry to identify specific modified residues

  • Create point mutations at putative modification sites to assess functional consequences

  • Use kinase/phosphatase inhibitors to manipulate modification states

Similar PTM analysis approaches have been used to study other plant ion channels, particularly in understanding how phosphorylation affects channel function, as seen in studies of P2K1/DORN1 transphosphorylating P2K2 in Arabidopsis .

What is the role of KCO1 in plant responses to abiotic stresses, and how can this be experimentally validated?

KCO1 likely plays significant roles in plant responses to various abiotic stresses, similar to other ion channels in Arabidopsis. For experimental validation, the following approaches are recommended:

  • Gene expression analysis:

    • qRT-PCR to measure KCO1 expression changes under different stress conditions

    • RNA-seq for genome-wide expression patterns in wild-type vs. KCO1 mutants

    • In situ hybridization to visualize tissue-specific expression changes

  • Phenotypic analysis:

    • Compare growth metrics (root length, biomass, etc.) between wild-type and KCO1 knockout/overexpression lines under stress conditions

    • Measure physiological parameters (stomatal conductance, water content, etc.)

    • Analyze stress-responsive metabolites

  • Electrophysiological measurements:

    • Patch-clamp analysis of protoplasts isolated from stressed plants

    • Non-invasive ion flux measurements (MIFE) to monitor K+ fluxes

  • Genetic approaches:

    • Complementation assays using wild-type or mutated KCO1 in knockout lines

    • Crossing with other stress-responsive mutants to assess genetic interactions

This multi-faceted approach draws from methodologies used to study other ion channels in stress responses, such as MSL10's role in hypo-osmotic shock adaptation .

What computational models best predict KCO1 structure-function relationships?

Computational modeling of KCO1 structure-function relationships requires integrating multiple approaches:

  • Homology modeling:

    • Based on crystallized potassium channel structures (e.g., KcsA, Kv, BK channels)

    • Refinement using molecular dynamics simulations

    • Validation through experimental mutagenesis

  • Molecular dynamics simulations:

    • All-atom simulations in explicit membrane environments

    • Analysis of calcium binding site dynamics

    • Ion permeation and selectivity mechanisms

    • Gating conformational changes

  • Systems biology approaches:

    • Integration of KCO1 function into broader signaling networks

    • Prediction of interactions with regulatory proteins

    • Modeling calcium-dependent activation pathways

  • Machine learning applications:

    • Prediction of critical residues for channel function

    • Classification of mutations as pathogenic or benign

    • Virtual screening for potential channel modulators

These computational approaches complement experimental methods and can generate testable hypotheses about structure-function relationships, similar to studies analyzing the cryo-electron microscopy structures of MSL10 that revealed heptameric channel assembly and a distinct gating mechanism .

How can CRISPR/Cas9 be optimized for targeted modification of KCO1 in Arabidopsis?

Optimizing CRISPR/Cas9 for KCO1 modification requires careful consideration of several factors:

  • gRNA design:

    • Select target sites with minimal off-target effects using prediction tools

    • Design 19-20 nucleotide sequences with NGG PAM sites

    • Prioritize targets in early exons to maximize disruption

    • Design multiple gRNAs targeting different regions for higher success

  • Vector construction:

    • Use plant-optimized Cas9 with appropriate promoters (e.g., CaMV 35S, UBQ10)

    • Express gRNAs under U6 or U3 promoters

    • Include appropriate selection markers (e.g., hygromycin, BASTA)

  • Transformation and screening:

    • Use floral dip transformation for Arabidopsis

    • Screen T1 transformants for Cas9 presence

    • Screen T2 generation for heritable mutations

    • Confirm mutations by sequencing

  • Analysis of edited plants:

    • Verify loss of KCO1 expression (RT-PCR, Western blot)

    • Assess phenotypic changes under various conditions

    • Perform complementation with wild-type KCO1 to confirm specificity

This approach is similar to genetic modification strategies used for other Arabidopsis genes, employing modern genome editing technologies to create precise modifications .

What are the most significant gene expression changes in KCO1 knockout lines under different stress conditions?

Gene expression changes in KCO1 knockout lines would likely reflect the channel's role in stress responses and ionic homeostasis. A comprehensive analysis might reveal:

Stress ConditionUpregulated PathwaysDownregulated PathwaysNotable Marker Genes
DroughtABA signaling, osmolyte synthesisCell expansion, water transportDREB2A, RD29A, P5CS1
Salt stressNa+/K+ transporters, ROS scavengingK+ uptake systems, growth-relatedSOS1, NHX1, APX1
Cold stressMembrane modifications, antifreeze proteinsMetabolic enzymesCBF1-3, COR15A
Heat stressHeat shock proteins, proteostasisPhotosynthesisHSP70, HSP90, HSFA2

To accurately identify these changes:

  • Perform RNA-seq on wild-type and KCO1 knockout plants under control and stress conditions

  • Use differential expression analysis to identify significantly changed genes

  • Perform GO term and pathway enrichment analysis

  • Validate key genes using qRT-PCR

  • Correlate expression changes with physiological and phenotypic observations

This approach is comparable to transcriptional response analyses performed for other ion channel mutants, such as examining eATP-induced transcriptional responses requiring CNGC2 .

How do electrophysiological properties of KCO1 variants with site-directed mutations compare to wild-type channels?

Comparing electrophysiological properties of KCO1 variants to wild-type channels requires systematic analysis of key channel characteristics:

  • Activation parameters:

    • Calcium sensitivity (EC50 values)

    • Voltage-dependence (V50 values)

    • Activation kinetics (τ activation)

  • Conductance properties:

    • Single-channel conductance

    • Open probability

    • Ion selectivity (relative permeability to different cations)

    • Rectification characteristics

  • Pharmacological responses:

    • Sensitivity to blockers (TEA, Ba2+, Cs+)

    • Modulation by regulatory molecules

  • Methodology for comparison:

    • Express wild-type and mutant channels in Xenopus oocytes or mammalian cells

    • Perform patch-clamp recordings under identical conditions

    • Analyze data using appropriate electrophysiological software

    • Use statistical analyses to determine significant differences

This approach is similar to electrophysiological analysis of other ion channels, such as studies on the gating of MSL10 that demonstrated how reorientation of phenylalanine side chains alone, without main chain rearrangements, may generate the hydrophobic gate .

What are the optimal protocols for KCO1 protein purification for structural studies?

Optimal protocols for KCO1 protein purification for structural studies involve several critical steps:

  • Expression system selection:

    • Insect cells (Sf9, High Five) usually provide highest yields for membrane proteins

    • Mammalian cells may provide more native-like post-translational modifications

    • Yeast (Pichia pastoris) offers cost-effective alternative with reasonable yields

  • Construct optimization:

    • Include affinity tags (His8, Flag, etc.) for purification

    • Consider fusion partners (GFP, MBP) to improve folding and stability

    • Engineer thermostability mutations if needed

    • Remove flexible regions for crystallization attempts

  • Solubilization and purification:

    • Screen detergents (DDM, LMNG, GDN) for optimal extraction

    • Consider using lipid nanodiscs or amphipols for stability

    • Employ multi-step purification (affinity, size exclusion, ion exchange)

    • Include calcium during purification to stabilize the channel

  • Quality control:

    • Size exclusion chromatography to assess monodispersity

    • Negative stain EM to verify protein integrity

    • Functional assays (e.g., liposome flux assays) to confirm activity

  • Structural analysis approaches:

    • Cryo-EM (most likely to succeed for membrane proteins)

    • X-ray crystallography (challenging but potentially higher resolution)

    • NMR for specific domains

These approaches align with structural biology methods used for other plant ion channels, such as the cryo-electron microscopy analysis of MSL10 structures in detergent and lipid environments .

How can electrophysiological and calcium imaging data be integrated to understand KCO1 function in intact tissues?

Integrating electrophysiological and calcium imaging data for understanding KCO1 function in intact tissues requires:

  • Experimental design:

    • Generate transgenic plants expressing both KCO1 variants and calcium indicators

    • Use genetically encoded calcium indicators (GCaMP6, R-GECO1) for less invasive measurements

    • Design stimuli that specifically activate KCO1-dependent pathways

    • Implement simultaneous recording setups for real-time correlation

  • Data acquisition protocols:

    • Perform patch-clamp recordings on cells in intact tissues or semi-intact preparations

    • Simultaneously capture calcium dynamics using confocal or two-photon microscopy

    • Record at sufficient temporal resolution (>10 Hz) to capture rapid events

    • Include calibration standards for quantitative calcium measurements

  • Analysis approaches:

    • Time-series correlation analysis between calcium signals and electrical activity

    • Frequency domain analysis to identify oscillatory patterns

    • Mathematical modeling of calcium-dependent activation kinetics

    • Spatial analysis of calcium wave propagation relative to channel activation

  • Validation experiments:

    • Pharmacological interventions to block specific pathways

    • Genetic perturbations (e.g., calcium buffer overexpression)

    • Controlled manipulation of calcium levels

This integrated approach is similar to methods used to study extracellular ATP-induced changes in root epidermal cell plasma membrane voltage and calcium dynamics requiring CNGC2 .

What machine learning approaches are most effective for analyzing large datasets from KCO1 mutant phenotyping experiments?

Machine learning approaches for analyzing KCO1 mutant phenotyping datasets should be selected based on the specific data types and research questions:

  • Supervised learning approaches:

    • Random Forests for phenotype classification and feature importance ranking

    • Support Vector Machines for binary phenotype classification

    • Gradient Boosting for predicting quantitative traits

    • Deep Neural Networks for complex pattern recognition in image-based phenotyping

  • Unsupervised learning methods:

    • Principal Component Analysis for dimensionality reduction

    • Hierarchical Clustering to identify groups of similar phenotypes

    • t-SNE or UMAP for visualization of high-dimensional phenotypic data

    • Self-Organizing Maps for pattern discovery

  • Data preparation and validation:

    • Feature scaling and normalization

    • Missing data imputation

    • Cross-validation (k-fold) for model evaluation

    • Independent test sets for final validation

  • Implementation workflow:

    • Data preprocessing and quality control

    • Feature selection or extraction

    • Model training and hyperparameter optimization

    • Model evaluation and biological interpretation

  • Specific applications for KCO1 research:

    • Root architecture phenotyping (growth patterns, branching)

    • Stress response classification

    • Gene expression pattern analysis

    • Electrophysiological trace classification

These approaches represent advanced data analysis methods suitable for complex datasets generated in ion channel research, enabling researchers to extract meaningful patterns from high-dimensional phenotypic data.

How does KCO1 function differ between Arabidopsis ecotypes, and what methods best capture this variation?

KCO1 function likely varies between Arabidopsis ecotypes due to genetic diversity, similar to how other ion channels show ecotype-specific variation. Methods to capture this variation include:

  • Genomic analysis:

    • Sequence KCO1 from multiple ecotypes to identify polymorphisms

    • Analyze promoter regions for regulatory variations

    • Perform genome-wide association studies (GWAS) linking KCO1 variants to phenotypes

    • Create haplotype networks to understand evolutionary relationships

  • Functional comparison:

    • Express KCO1 variants from different ecotypes in heterologous systems

    • Compare electrophysiological properties (calcium sensitivity, conductance)

    • Analyze protein stability and trafficking differences

    • Study protein-protein interaction variations

  • Physiological assessment:

    • Compare stress responses across ecotypes with different KCO1 variants

    • Measure potassium content and flux in various tissues

    • Analyze growth patterns under challenging conditions

    • Examine calcium signaling responses

  • Genetic approaches:

    • Create reciprocal transformants (KCO1 gene swap between ecotypes)

    • Analyze quantitative trait loci (QTL) associated with KCO1 function

    • Perform complementation tests with various KCO1 alleles

This approach is comparable to studies examining variation in recombination events between different Arabidopsis accessions, where genomic landscapes were analyzed in detail .

What are the key differences in experimental approaches when studying KCO1 in roots versus leaves?

Studying KCO1 in roots versus leaves requires adapting experimental approaches to the specific characteristics of each tissue:

ParameterRoot ApproachLeaf ApproachKey Considerations
Tissue preparationHydroponics, vertical growth platesRosette growth, controlled light conditionsDevelopmental stage standardization
Live imagingTransparent chambers, cover-slip systemsInfiltration techniques, abaxial surface accessMinimizing tissue damage
ElectrophysiologyRoot hair cells, epidermal cells, protoplastsMesophyll protoplasts, guard cellsCell type selection impacts results
Expression analysisRoot zone-specific sampling, cell-type specific promotersLayer-specific isolation, microdissectionSpatial resolution is critical
PhenotypingRoot architecture, growth kinetics, ion contentPhotosynthetic parameters, water retention, stomatal behaviorFunction-specific metrics

Additional considerations:

  • Root studies require attention to:

    • Gravitropic responses

    • Nutrient availability in growth media

    • Sterile conditions to prevent microbial interference

    • Zone-specific responses (elongation vs. maturation)

  • Leaf studies require attention to:

    • Light conditions and photosynthetic activity

    • Developmental stage and leaf position

    • Stomatal density and behavior

    • Transpiration and water status

These tissue-specific approaches are similar to methods used to study CNGC2 in root epidermis, where specialized techniques were employed to measure extracellular ATP-induced changes in root epidermis plasma membrane properties .

How can KCO1 structure-function insights be applied to improve crop stress tolerance through genetic engineering?

Applying KCO1 structure-function insights to crop improvement requires translational research approaches:

  • Target identification:

    • Identify KCO1 homologs in crop species through bioinformatics

    • Characterize their expression patterns under stress conditions

    • Determine if natural variation in these genes correlates with stress tolerance

    • Prioritize targets based on predicted functional impact

  • Engineering strategies:

    • Modify calcium sensitivity through targeted mutations in calcium-binding domains

    • Alter expression patterns using stress-inducible or tissue-specific promoters

    • Enhance channel stability through protein engineering

    • Create synthetic variants with optimized gating properties

  • Validation in model crops:

    • Generate transgenic lines with modified KCO1 homologs

    • Characterize physiological responses to stress conditions

    • Measure ion homeostasis parameters

    • Assess yield components under controlled stress

  • Field testing considerations:

    • Multi-location trials under varying environmental conditions

    • Assessment of stress resilience in agricultural settings

    • Evaluation of potential ecological impacts

    • Analysis of yield stability across environments

  • Regulatory and biosafety aspects:

    • Characterize potential unintended effects

    • Design appropriate containment strategies

    • Prepare comprehensive risk assessment documentation

    • Address regulatory requirements for commercial development

This translational approach draws from fundamental research on plant ion channels to develop practical applications, similar to how insights from mechanosensitive channel studies in Arabidopsis have informed understanding of plant adaptation to different osmotic environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.