Recombinant Arabidopsis thaliana Calcium sensing receptor, chloroplastic (CAS)

Shipped with Ice Packs
In Stock

Description

Production Methods for Recombinant CAS

Recombinant CAS is produced using diverse expression systems, with varying efficiencies:

Host SystemPurityApplications
E. coli/Yeast≥85% (SDS-PAGE)Structural studies, antibody development .
Mammalian Cells≥85% (SDS-PAGE)Functional assays requiring post-translational modifications .
Arabidopsis Super-Expression SystemUp to 0.4 mg/g FWNative complex assembly (e.g., oligosaccharyltransferase) .

Key Considerations:

  • Partial vs. Full-Length: Partial constructs are often used for membrane protein studies, while full-length versions are preferred for functional analysis .

  • Purification: Antigen-affinity chromatography is employed for antibody generation (e.g., rabbit anti-CAS IgG) .

Stomatal Regulation

CAS mediates extracellular Ca²⁺-induced stomatal closure via:

  1. Ca²⁺ Transients: CAS amplifies cytosolic Ca²⁺ signals, triggering H₂O₂ and NO production .

  2. Signaling Cross-Talk: Interacts with abscisic acid (ABA) pathways and antioxidant systems (e.g., ATRBOH, Atnoa1) .

Experimental Validation:

  • cas mutants show impaired stomatal closure and Ca²⁺ responses to external Ca²⁺ .

  • Fluorescent reporters (e.g., YC3.6) confirm CAS-dependent Ca²⁺ dynamics in guard cells .

Photosynthetic Stress Response

Under high light or CO₂ deprivation:

  • Phosphorylation: STN8 kinase phosphorylates CAS, influencing LHCII dynamics and CEF .

  • Functional Similarity: cas mutants mimic tap38 and pgr5 phenotypes, linking CAS to photoprotection and redox balancing .

Applications in Biotechnology

  1. Plant Stress Research: Recombinant CAS aids in studying drought, salinity, and oxidative stress responses .

  2. Protein Production: Arabidopsis-based systems enable native complex assembly (e.g., oligosaccharyltransferase) .

  3. Therapeutic Targets: CAS-related signaling pathways may inform strategies for improving crop resilience .

Challenges and Considerations

  • Heterologous Expression: Eukaryotic systems (e.g., mammalian cells) may lack proper post-translational modifications .

  • Functional Analysis: Partial CAS constructs may lack critical domains for calcium sensing .

  • Purity Standards: ≥85% purity is standard for structural studies but may require optimization for biochemical assays .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CAS; STR3; At5g23060; MYJ24.5; Calcium sensing receptor, chloroplastic; Sulfurtransferase 3; AtStr3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-387
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CAS
Target Protein Sequence
VSLPTSTSISLLSLFASPPHEAKAAVSIPKDQIVSSLTEVEKTINQVQETGSSVFDATQR VFQVVGDALKPALDTALPIAKQAGEEAMKLASPAFSEASKKAQEAMQSSGFDSEPVFNAA KTVTDVAQQTSKAIEDAKPIASSTMDTISSADPSVIVVAAGAAFLAYLLLPPVFSAISFN FRGYKGDLTPAQTLDLLCTKNYLMVDIRSEKDKEKAGIPRLPSNAKNRVISIPLEELPNK VKGIVRNSKRVEAEIAALKISYLKKINKGSNIIILDSYTDSAKIVAKTLKVLGYKNCYIV TDGFSGGRGWLQSRLGTDSYNFSFAQVLSPSRIIPAASRSFGTRSGTKFLPSSD
Uniprot No.

Target Background

Function
This protein modulates cytoplasmic Ca²⁺ concentration, playing a crucial role in stomatal regulation in response to elevated extracellular Ca²⁺. It may function by regulating inositol 1,4,5-trisphosphate (IP3) concentrations, which in turn trigger Ca²⁺ release from intracellular stores. It may also participate in de-etiolation.
Gene References Into Functions
  1. The calcium-sensing receptor (CAS) regulates transpiration and optimizes photosynthesis by influencing stomatal movement and photosynthetic electron transport, thus affecting water use efficiency (WUE) and drought tolerance. PMID: 24187420
  2. Studies show that intracellular Ca²⁺ ([Ca²⁺]i) oscillations are synchronized with extracellular Ca²⁺ oscillations largely through the Ca²⁺-sensing receptor CAS. CAS regulates inositol 1,4,5-trisphosphate concentration, which directs Ca²⁺ release from internal stores. PMID: 17347443
  3. Arabidopsis studies highlight the significant role of the calcium-sensing receptor (CaS) in plant growth and development. PMID: 18331354
  4. CAS, a chloroplast-localized protein, is essential for proper stomatal regulation in response to elevated external Ca²⁺. PMID: 18507772
Database Links

KEGG: ath:AT5G23060

STRING: 3702.AT5G23060.1

UniGene: At.24421

Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein; Stromal side.
Tissue Specificity
Predominantly expressed in the shoot, including guard cells.

Q&A

Basic Research Questions

  • What is the Calcium Sensing Receptor (CAS) in Arabidopsis thaliana and where is it localized?

    The Calcium Sensing Receptor (CAS) is a thylakoid membrane-localized protein in Arabidopsis thaliana that functions as a crucial regulator of extracellular calcium-induced stomatal closure. CAS contains a rhodanese-like protein domain that has been associated with specific stress conditions. Structurally, CAS is positioned within the chloroplast thylakoid membrane where it senses changes in extracellular Ca²⁺ concentration and regulates intracellular Ca²⁺ responses, initiating downstream signal transduction processes that help plants respond to environmental stresses .

  • What are the primary functions of CAS in Arabidopsis thaliana?

    CAS performs several critical functions in Arabidopsis:

    • Senses changes in extracellular Ca²⁺ concentration and mediates increases in cytosolic Ca²⁺ concentration

    • Regulates stomatal closure in response to extracellular calcium

    • Participates in hydrogen peroxide (H₂O₂) and nitric oxide (NO) signaling pathways

    • Enhances plant resistance to drought stress by decreasing cell membrane damage

    • Increases osmoprotectant production (e.g., proline) under stress conditions

    • Maintains photosynthetic capacity during abiotic stresses

    • Functions in the cascade involving H₂O₂, ABA, and NO in guard cell signaling

  • How is CAS involved in the regulation of stomatal movement?

    CAS regulates stomatal movement through a complex signaling cascade:

    1. When extracellular Ca²⁺ levels increase, CAS senses this change and mediates an increase in cytosolic Ca²⁺ concentration

    2. This triggers the production of hydrogen peroxide (H₂O₂) and nitric oxide (NO) in guard cell chloroplasts

    3. These signaling molecules act downstream of CAS and are involved in the CAS-IP₃ signaling pathway

    4. H₂O₂ may directly or indirectly regulate CAS activity as redox signaling molecules

    5. NO plays a downstream role relative to CAS in the signal transduction pathway

    6. The collective interaction among CAS, H₂O₂, and NO signals ultimately induces stomatal closure

    Studies with CAS antisense lines (CASas) have shown that ABA-induced signal transduction for stomatal closure is not dependent on CAS, indicating parallel pathways for stomatal regulation .

Advanced Research Questions

  • What methodologies are most effective for expressing and purifying recombinant CAS protein for functional studies?

    Several successful approaches have been documented:

    MethodDescriptionAdvantagesConsiderations
    YFP-taggingC-terminal fusion with YFP followed by immunoaffinity purification using anti-GFP microbeadsPreserves CAS activity; enables visualization; facilitates purificationRequires 1g of leaf tissue per purification; produces a brown eluate containing active CAS
    Bacterial expressionExpression in E. coli strain ER2566 under native conditions using IMPACT™-TWIN systemMore abundant protein yield; suitable for in vitro assaysShorter tags (HIS₆ or MYC) may hamper substrate binding affinity
    Plant transformationAgrobacterium-mediated floral dip transformation of Arabidopsis with CAS-expression constructsAllows in vivo functional studies in plant systemsTime-consuming; requires selection of homozygous lines

    Key considerations include maintaining protein activity during purification by including cofactors like PLP (pyridoxal 5′-phosphate) in buffers, and selecting appropriate fusion tags that don't interfere with substrate binding. C-terminal YFP fusion has been demonstrated to maintain CAS functionality while facilitating purification, whereas shorter tags like HIS₆ or MYC can increase the Km for cyanide by approximately 8-fold compared to native CAS protein .

  • How can CRISPR/Cas9 technology be effectively utilized to study CAS function in Arabidopsis?

    CRISPR/Cas9 can be used to modify the CAS gene through several approaches:

    1. Design strategy:

      • Target specific domains of CAS protein (e.g., rhodanese-like domain)

      • Design sgRNAs with minimal off-target effects

      • Consider using germline-specific promoters to express Cas9 for higher editing efficiency

    2. Transformation methodology:

      • Use the floral dip method for Arabidopsis transformation

      • Consider sequential transformation approach using Cas9-expressing parental lines for higher efficiency

      • Select appropriate promoters (germline-specific promoters show higher efficiencies)

    3. Mutation analysis approach:

      • Perform systematic multi-generational analysis (T1, T2, T3)

      • Screen for homozygous mutations in T2 generation (approximately 22% efficiency)

      • Verify heritability in T3 plants following Mendelian inheritance patterns

    Recent research has shown that using germline-specific promoters (e.g., EC1.1/EC1.2) to express Cas9 can significantly improve the frequency and heritability of mutations in Arabidopsis with homozygous mutation rates of up to 17% in the T1 generation .

  • What are the current challenges in studying CAS phosphorylation and its impact on signaling pathways?

    Several challenges exist in studying CAS phosphorylation:

    1. Multiple phosphorylation sites: CAS contains several evolutionary conserved phosphorylation sites, making it difficult to dissect the contribution of individual sites.

    2. Kinase redundancy: Studies indicate that CAS is not an exclusive target of a single kinase but can be phosphorylated by multiple kinases including STN7 and STN8, suggesting redundant mechanisms.

    3. Methodological limitations:

      • In vitro kinase assays may not fully recapitulate in vivo conditions

      • Phosphosite variants need to be carefully designed to avoid disrupting protein structure

      • Distinguishing direct vs. indirect phosphorylation events is challenging

    4. Integration with other signaling pathways: CAS phosphorylation appears to be integrated with the STN7/STN8/TAP38-dependent photoacclimation network, adding complexity to the analysis.

    Recent approaches have included using recombinant CAS fragments (CAS-C and CAS-N) and creating non-phosphorylatable variants (e.g., CAS-C T376V, CAS-C S378A) to dissect the roles of specific phosphorylation sites. Additionally, comparative studies using thylakoid membranes from wild-type, stn7, stn8, and stn7/8 double mutants have helped elucidate the contributions of different kinases to CAS phosphorylation .

  • How do CAS homologs from different plant species compare functionally, and what are the best practices for heterologous expression studies?

    Comparative studies of CAS homologs from different species have revealed:

    SpeciesCAS HomologFunctional CharacteristicsHeterologous Expression Findings
    Arabidopsis thalianaAtCASChloroplast-localized; involved in stomatal closure; drought resistanceReference standard for comparison
    Oryza sativaOsCASContains rhodanese-like domain; similar Ca²⁺ sensing capabilitySuccessfully complemented Arabidopsis cas knockout; enhanced drought resistance when expressed in Arabidopsis

    Best practices for heterologous expression studies:

    1. Vector selection:

      • Use CaMV 35S promoter for strong constitutive expression

      • Consider tissue-specific promoters for targeted expression

    2. Transformation method:

      • For Arabidopsis: Agrobacterium-mediated floral dip transformation

      • For expression analysis: Monitor both mRNA (real-time PCR) and protein levels (western blot)

    3. Functional validation:

      • Demonstrate subcellular localization using fluorescent protein tags

      • Perform complementation assays in knockout mutants

      • Assess physiological parameters (stomatal responses, stress tolerance)

    4. Authentication criteria for CAS function:

      • High CAS to OASS (O-acetylserine sulfhydrylase) activity ratio

      • Proper mitochondrial/chloroplast localization

      • Appropriate inhibition profile at high concentrations of substrate

    When OsCAS from rice was expressed in Arabidopsis cas knockout mutants, it successfully complemented the phenotype, demonstrating functional conservation across species. The transgenic plants showed improved drought resistance, with lower RMP (relative membrane permeability) and MDA (malondialdehyde) contents and higher proline content after drought stress .

  • What are the methodological approaches for studying CAS-dependent calcium signaling in intact plants?

    Several methodological approaches can be employed:

    1. Calcium imaging techniques:

      • Use of genetically encoded calcium indicators (GECIs) like GCaMP or YC3.6

      • Application of calcium-sensitive dyes (e.g., Fluo-4, Fura-2) with appropriate loading protocols

      • Implementation of PH PLCδ-GFP imaging for visualizing IP₃-dependent signaling in guard cells

    2. Electrophysiological measurements:

      • Patch-clamp recordings of calcium channels in guard cells

      • Multi-electrode array recordings for spatiotemporal analysis of calcium waves

    3. Genetic tools:

      • CAS knockout/knockdown lines (e.g., cas-1, SALK_070416)

      • CAS overexpression lines

      • CAS phosphorylation site mutants

    4. Pharmacological approaches:

      • Calcium channel blockers/activators

      • H₂O₂ and NO modulators to study downstream signaling

      • Application of external Ca²⁺ at varying concentrations

    5. Physiological measurements:

      • Stomatal aperture measurements under different calcium regimes

      • Chlorophyll fluorescence parameters (e.g., electron transport rate, PSII quantum yield)

      • Drought stress resistance assessment

    A comprehensive approach combining these methods enables researchers to link molecular mechanisms to physiological responses. For instance, studies using Arabidopsis plants expressing PH PLCδ-GFP protein for guard cell imaging have demonstrated that H₂O₂ and NO are involved in the CAS-IP₃ signaling pathway .

  • How does CAS function change under different abiotic stress conditions, and what experimental designs best capture these dynamics?

    CAS function varies significantly under different abiotic stresses:

    Stress ConditionCAS-Related ResponseExperimental Design Recommendations
    DroughtEnhanced stomatal closure; increased proline content; maintained photosynthetic capacity21-day controlled drought protocol; measure RMP, MDA, proline content, and chlorophyll fluorescence parameters
    High lightInvolvement in photoacclimation network; interaction with STN7/STN8/TAP38Compare wild-type and cas mutants under different light intensities; measure 77K chlorophyll fluorescence emission
    Calcium stressRegulation of cytosolic Ca²⁺ concentration; modulation of stomatal apertureGrowth at varying Ca²⁺ concentrations (high/medium/low); measure stomatal conductance and Ca²⁺ transients
    Etiolation/De-etiolationPromotion of de-etiolation in response to light and external Ca²⁺Compare etiolated seedlings under different Ca²⁺ concentrations; analyze chlorophyll accumulation and chloroplast development

    Best experimental designs include:

    1. Comparative physiological analysis:

      • Wild-type vs. cas knockout vs. CAS overexpression lines

      • Multiple time points during stress application

      • Recovery phase measurements after stress alleviation

    2. Multi-parameter assessment:

      • Oxidative damage biomarkers (MDA, RMP)

      • Osmoprotectant levels (proline)

      • Photosynthetic parameters (ETR, ΦPSII, NPQ)

      • Stress hormone levels (ABA)

    3. Controlled environment experiments:

      • Precise regulation of light, humidity, temperature

      • Gradual vs. sudden stress application

      • Combined stresses to mimic natural conditions

    Studies have shown that CAS-overexpressing plants exhibit better resistance to drought stress by decreasing cell membrane damage, increasing osmoprotectant production, and maintaining higher photosynthetic capacity compared to wild-type and cas knockout plants .

  • What is the relationship between CAS and chloroplast development, and how can researchers effectively study this interaction?

    CAS plays important roles in chloroplast development:

    1. De-etiolation process:

      • High Ca²⁺ and CAS expression promote de-etiolation in Arabidopsis after light exposure

      • CAS expression is upregulated by white light and external Ca²⁺

      • CAS antisense plants show lower chlorophyll content and delayed chloroplast development

    2. Chloroplast functionality:

      • CAS affects electron transport rate and effective PSII quantum yield

      • Influences energy dissipation mechanisms in PSII

      • Participates in H₂O₂ generation from chloroplasts in guard cells

    Effective research approaches:

    1. Developmental studies:

      • Track chloroplast development during seedling growth under different Ca²⁺ regimes

      • Compare etiolated seedlings of wild-type and cas mutants during light exposure

      • Monitor chlorophyll accumulation and plastid ultrastructure using microscopy

    2. Molecular techniques:

      • Analyze expression of chloroplast development genes in cas backgrounds

      • Use chloroplast-targeted fluorescent proteins to visualize structural changes

      • Apply techniques like chloroplast isolation followed by proteomics/metabolomics

    3. Physiological measurements:

      • Chlorophyll fluorescence parameters (Fv/Fm, ΦPSII, NPQ)

      • Photosynthetic gas exchange

      • Reactive oxygen species (ROS) levels in chloroplasts

    4. Genetic approaches:

      • Generate double mutants between cas and other chloroplast development genes

      • Create chloroplast-specific CAS overexpression lines

      • Use inducible systems to control CAS expression at specific developmental stages

    Research has demonstrated that high Ca²⁺ significantly increases chlorophyll content and improves chloroplast development in both wild-type and CASas etiolated seedlings during de-etiolation, with expression levels of CAS mRNA and protein being upregulated by white light and external Ca²⁺ .

  • What are the most effective chloroplast transformation strategies for studying CAS function in different plant species?

    Several chloroplast transformation strategies can be employed:

    1. Vector design considerations:

      • Include species-specific homologous recombination elements (e.g., trnI/trnA flanking sequences)

      • Select appropriate promoters (e.g., Prrn from C. reinhardtii)

      • Utilize bicistronic arrangements for marker genes and genes of interest

      • Include appropriate untranslated regions (UTRs) and terminators

    2. Transformation methods by species:

      Plant SpeciesPreferred MethodSpecial Considerations
      Arabidopsis thalianaAgrobacterium-mediated floral dipLower chloroplast transformation efficiency; focus on nuclear-encoded CAS
      Chlamydomonas reinhardtiiGlass bead agitation or electroporationModel system for chloroplast transformation; high efficiency
      Chlorella vulgarisElectroporation with carbohydrate-based buffersUse sorbitol-mannitol or sorbitol buffers for higher efficiency
      Crop plantsBiolistic transformationGold particles coated with DNA; requires tissue culture
    3. Selection and confirmation strategies:

      • Antibiotic resistance markers (e.g., Aph6 for kanamycin resistance)

      • PCR confirmation of integration (e.g., 2.8-kb amplicon for successful integration)

      • Western blot analysis for protein expression

      • Phenotypic assays for functional complementation

    For chloroplast transformation specifically, a fully synthetic approach can be an efficient strategy, as demonstrated with the pCMCC (Chula Mexico Chlorella chloroplast) vector for Chlorella vulgaris. This vector included trnI/trnA flanking sequences that mediate site-directed insertion without interrupting endogenous genes, and the trnI gene contains a chloroplast replication origin that promotes vector integration .

  • How do post-translational modifications of CAS affect its function, and what techniques can be used to study them?

    Post-translational modifications of CAS significantly impact its function:

    1. Phosphorylation:

      • Multiple conserved phosphorylation sites have been identified

      • Both STN7 and STN8 kinases can phosphorylate CAS

      • Phosphorylation status affects CAS activity and signaling

    2. Other potential modifications:

      • Redox regulation through cysteine residues

      • Calcium-dependent structural changes

      • Potential protein-protein interactions affecting function

    Techniques for studying post-translational modifications:

    1. Mass spectrometry approaches:

      • Phosphoproteomics to identify phosphorylation sites

      • MS/MS fragmentation for precise site localization

      • Quantitative MS to measure modification stoichiometry

    2. Biochemical methods:

      • In vitro kinase assays with purified thylakoid membranes

      • Phosphatase treatments to study dephosphorylation

      • Mobility shift assays (Phos-tag SDS-PAGE)

    3. Genetic strategies:

      • Non-phosphorylatable mutants (e.g., Ser/Thr to Ala)

      • Phosphomimetic mutants (e.g., Ser/Thr to Asp/Glu)

      • Kinase/phosphatase mutant backgrounds (stn7, stn8, stn7/8, tap38)

    4. Structural biology:

      • X-ray crystallography of modified and unmodified CAS

      • NMR spectroscopy for dynamic studies

      • Hydrogen-deuterium exchange mass spectrometry

    Studies comparing phosphorylation of recombinant CAS-C in thylakoids from wild-type, stn7, stn8, and stn7/8 mutants have shown that both STN7 and STN8 can phosphorylate CAS, with possible compensatory mechanisms affecting targets when one kinase is absent. Phosphorylation patterns suggest integration of CAS within the STN7/STN8/TAP38-dependent photoacclimation network .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.