Recombinant Arabidopsis thaliana CASP-like protein At1g79780 (At1g79780)

Shipped with Ice Packs
In Stock

Description

Membrane Domain Formation

At1g79780 localizes to the Casparian strip membrane domain (CSD) in root endodermal cells, creating a diffusion barrier that restricts lateral movement of ions and molecules . This scaffolding role is independent of lignin deposition but facilitates peroxidase-mediated lignin polymerization in adjacent cell walls .

Evolutionary Conservation

Orthologs in Lotus japonicus and Citrullus lanatus share structural and functional similarities, including endodermis-specific expression and CSD localization, underscoring evolutionary conservation .

Recombinant Production

Commercially available recombinant At1g79780 is produced in E. coli systems with high purity (>95%). Key production details include:

ParameterSpecification
Expression SystemE. coli
Storage BufferTris-based buffer with 50% glycerol
StabilityStable at -20°C long-term; working aliquots stable at 4°C for ≤1 week
PurityVerified via SDS-PAGE and mass spectrometry

Localization Mechanism

  • EL2 Mutations: Substitutions (e.g., W164G) disrupt CSD localization, while EL2 deletion (Δ158:175) only accelerates protein turnover .

  • EL1 Deletions: Removal of EL1 (Δ72:80) delays CSD enrichment but does not abolish it, suggesting a regulatory role .

Functional Redundancy

  • In Arabidopsis, CASP homologs (e.g., AtCASPL4C1/At3g55390) exhibit functional redundancy, where single mutants show no developmental defects, but higher-order mutants display compromised barriers .

Applications and Future Directions

Recombinant At1g79780 is primarily used to study:

  1. Membrane Domain Dynamics: Mechanisms of plasma membrane scaffolding and protein diffusion barriers.

  2. Cell Wall Modification: Interactions with peroxidases for lignin deposition .

  3. Evolutionary Studies: Comparative analysis of CASP-like proteins in barrier formation across plant species .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify it in your order remarks. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development with the specified tag.
Synonyms
At1g79780; F20B17.26; CASP-like protein 3A2; AtCASPL3A2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At1g79780
Target Protein Sequence
MTSNGEGGEVVAKRRRKGIKELVQVALRGGCLAASATAMAVMLTATEEGVADIYGFKLTL SSNWSFSPSYQYVVGACAGTVLYSLLQLCLGVYRLVTGSPITPSRFQAWLCFTSDQLFCY LMMSAGSAGSGVTNLNKTGIRHTPLPDFCKTLSSFCNHVALSLLLVFLSFIFLASSSFFT VLVLSTP
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G79780

STRING: 3702.AT1G79780.1

UniGene: At.52573

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Arabidopsis thaliana CASP-like protein At1g79780?

At1g79780 is a CASP-like (CASPL) protein belonging to the larger family of Casparian strip membrane proteins found in Arabidopsis thaliana. These proteins share significant structural homology with the core CASP proteins (CASP1-5) that are critical for Casparian strip formation in plant endodermis. The At1g79780 protein contains the characteristic four transmembrane domains with cytoplasmic N and C termini typical of the CASPL family, with conserved residues in the transmembrane domains, particularly an arginine in TM1 and an aspartic acid in TM3 . Unlike the primary CASPs directly involved in Casparian strip formation, CASP-like proteins may have diversified functions in various plant tissues or developmental contexts.

How does At1g79780 relate to other CASP family proteins?

At1g79780 belongs to the extended CASPL family that evolved alongside the core CASP proteins involved in Casparian strip formation. Phylogenetic analysis reveals that CASPs and CASPLs are part of the MARVEL protein family, characterized by conserved transmembrane domains . While core CASPs (such as AtCASP1-5) contain a distinctive nine-amino acid signature (ESLPFFTQF) in their first extracellular loop (EL1) that is highly conserved among spermatophytes, CASP-like proteins show greater sequence diversity in this region. This suggests that At1g79780 may have evolved specialized functions distinct from core CASPs while maintaining structural similarities in key domains. The conservation patterns across plant species indicate that CASPL proteins represent an ancient protein family that diversified to serve various membrane organization functions .

Where is At1g79780 expressed in Arabidopsis thaliana?

Expression pattern analysis of At1g79780 shows different tissue distribution compared to core CASPs, which are predominantly expressed in the endodermis. While expression data specific to At1g79780 is limited in the provided search results, CASP-like proteins generally show broader expression patterns across multiple tissues. Promoter analysis and GFP fusion experiments with related CASPL proteins suggest that their expression is regulated by tissue-specific promoters . Research techniques to determine expression patterns include quantitative RT-PCR, promoter-reporter fusion constructs, and in situ hybridization. For a definitive expression map of At1g79780, researchers should perform tissue-specific transcriptome analysis or create promoter::GUS/GFP reporter lines to visualize expression domains throughout plant development.

How do mutations in conserved domains affect At1g79780 localization and function?

Mutations in highly conserved residues of CASP proteins significantly impact their localization and function, providing insight into potential effects in At1g79780. Studies with AtCASP1 demonstrate that altering the conserved aspartic acid in the third transmembrane domain (TM3) prevents proper protein expression, suggesting this residue is essential for correct protein folding . Similarly, mutations in specific residues of the second extracellular loop (EL2) affect CASP localization to varying degrees, with some mutations causing prolonged persistence at lateral plasma membranes or delayed localization at the Casparian strip domain (CSD) .

For At1g79780, researchers should focus on:

  • Site-directed mutagenesis of the conserved Arg in TM1 and Asp in TM3

  • Analysis of extracellular loop mutations, particularly in conserved residues

  • Creation of chimeric proteins to identify domains responsible for localization

These approaches will help determine whether At1g79780 localization depends on the same conserved residues as core CASPs or has evolved distinct mechanisms for membrane targeting.

What protein-protein interactions does At1g79780 participate in?

Elucidating the protein interaction network of At1g79780 is crucial for understanding its function. Based on research with related CASP proteins, potential interaction partners may include:

  • Other CASP/CASPL family members that form oligomeric complexes

  • Rab-GTPase subfamily proteins, which are known exocyst activators and potential CASP-interactors

  • Cell wall modification enzymes that participate in localized cell wall deposition

Methodology for investigating these interactions should include:

Table 1. Methods for Identifying Protein-Protein Interactions of At1g79780

TechniqueApplicationAdvantagesLimitations
Proximity-labeling (BioID)In vivo identification of proteins in close proximityDetects transient and stable interactions in native conditionsMay identify spatial neighbors rather than direct interactors
Co-immunoprecipitationVerification of specific interactionsIdentifies stable protein complexesMay miss weak or transient interactions
Yeast two-hybrid screeningIdentification of direct binding partnersHigh-throughput screening of potential interactorsHigh false positive rate, artificial conditions
Split-GFP complementationVisualization of interactions in plantaConfirms interactions in native cellular contextRequires protein engineering that may affect function

Recent findings with core CASPs suggest they participate in excluding vesicle tethering factors and interact with Rab-GTPases to regulate exocyst dynamics . Similar studies with At1g79780 would reveal whether it shares these interaction networks or participates in distinct cellular processes.

How does the evolutionary conservation of At1g79780 compare across plant species?

Evolutionary analysis of At1g79780 orthologs can provide insights into its functional importance. CASP-like proteins show varying degrees of conservation across the plant kingdom, with some features being highly conserved while others show lineage-specific adaptations . The presence of CASP homologs in green algae suggests an ancient origin for this protein family, predating the evolution of vascular plants .

Key evolutionary considerations for At1g79780 include:

  • Conservation of transmembrane domains across diverse plant species

  • Presence or absence of specialized sequence motifs in extracellular loops

  • Lineage-specific expansions or contractions of the gene family

  • Correlation between protein structure conservation and functional specialization

Comparing At1g79780 sequences from diverse plant species, from bryophytes to angiosperms, would reveal which domains are under strong selective pressure and therefore likely critical for function. Additionally, analysis of gene duplication events can help trace the evolutionary history and functional diversification of the CASPL family to which At1g79780 belongs.

What expression systems are optimal for producing recombinant At1g79780?

Producing functional recombinant At1g79780 requires careful consideration of expression systems that can properly fold membrane proteins with multiple transmembrane domains. Based on research with related proteins, the following expression systems should be considered:

Table 2. Expression Systems for Recombinant At1g79780 Production

Expression SystemAdvantagesDisadvantagesOptimization Strategies
E. coliRapid growth, high yield, low costMay not properly fold plant membrane proteinsUse specialized strains (C41/C43), low temperature induction, fusion tags
Yeast (S. cerevisiae, P. pastoris)Eukaryotic folding machinery, post-translational modificationsLower yields than bacteriaOptimize codon usage, use inducible promoters, screen multiple clones
Insect cellsMore complex eukaryotic system, better for complex proteinsHigher cost, slower productionBaculovirus expression vectors, optimize MOI and harvest time
Plant expression systemsNative folding environment, appropriate post-translational modificationsLower yields, longer production timeTransient expression in N. benthamiana, use of viral vectors

For membrane proteins like At1g79780 with multiple transmembrane domains, expression often requires:

  • N-terminal or C-terminal fusion tags for detection and purification

  • Careful selection of detergents for membrane extraction and protein solubilization

  • Optimization of induction conditions to prevent protein aggregation

  • Verification of proper folding using circular dichroism or limited proteolysis

When designing expression constructs, researchers should consider deleting or modifying potential signal peptides and testing multiple construct designs with varying N- and C-terminal boundaries to identify optimal expression conditions.

How can protein localization and dynamics of At1g79780 be visualized in living cells?

Visualizing At1g79780 localization and dynamics requires fluorescent protein fusions and advanced microscopy techniques. Based on successful approaches with other CASP proteins, researchers should consider:

  • Fusion protein design:

    • C-terminal and N-terminal GFP/mCherry fusions to determine optimal tagging strategy

    • Split-GFP complementation to minimize interference with protein function

    • Photoconvertible fluorescent proteins (e.g., mEos) for pulse-chase experiments

  • Expression strategy:

    • Native promoter constructs to maintain physiological expression levels

    • Inducible promoters for controlled expression timing

    • Cell-type specific promoters to study function in different tissues

  • Imaging techniques:

    • Confocal microscopy for basic localization studies

    • FRAP (Fluorescence Recovery After Photobleaching) to measure protein mobility

    • TIRF microscopy for detailed membrane domain analysis

    • Super-resolution microscopy (STED, PALM/STORM) for nanoscale organization

Studies with related CASP proteins have shown that fluorescent protein fusions can successfully localize to membrane domains while maintaining function . When At1g79780-GFP constructs are expressed in Arabidopsis, researchers should monitor protein dynamics during various developmental stages and in response to environmental stresses to fully characterize its behavior in planta.

What are the best methods for functional characterization of At1g79780?

Comprehensive functional characterization of At1g79780 requires multiple complementary approaches:

  • Genetic approaches:

    • CRISPR/Cas9 gene editing to generate knockout mutants

    • RNAi or artificial microRNA for tissue-specific knockdowns

    • Complementation studies using wild-type and mutated versions

    • Overexpression analysis to identify gain-of-function phenotypes

  • Biochemical approaches:

    • In vitro reconstitution of membrane domains using purified proteins

    • Liposome binding assays to test membrane association properties

    • Protein-lipid overlay assays to identify specific lipid interactions

    • Crosslinking and mass spectrometry to identify interaction partners

  • Cell biological approaches:

    • Immunolocalization studies with domain-specific antibodies

    • Correlation with membrane domain markers

    • Developmental timeline of protein expression and localization

    • Response to cell wall disrupting agents and osmotic stress

  • Omics approaches:

    • Transcriptomics of knockout mutants to identify affected pathways

    • Proteomics to identify changes in protein abundance or modification

    • Metabolomics to detect changes in cell wall components or signaling molecules

Based on studies with core CASPs, researchers should pay particular attention to potential roles in membrane domain formation, cell wall modification, and barrier function establishment . A combination of these approaches will provide comprehensive insights into At1g79780 function.

How can phenotypic data from At1g79780 mutants be quantitatively analyzed?

Phenotypic analysis of At1g79780 mutants requires rigorous quantitative approaches to detect potentially subtle changes. Based on studies with related CASP proteins, key phenotypes to analyze include:

Table 3. Quantitative Phenotypic Analysis Methods for At1g79780 Mutants

Phenotype CategoryMeasurement TechniqueQuantification MethodStatistical Analysis
Growth parametersPrimary root length, lateral root numberImage analysis software (ImageJ/Fiji)ANOVA, regression analysis
Cell wall compositionLignin staining (phloroglucinol)Colorimetric quantificationt-test, ANOVA
Barrier functionPropidium iodide penetration assayFluorescence intensity profilesMixed effects models
Stress responsesSurvival under osmotic/salt stressSurvival curves, chlorophyll contentKaplan-Meier analysis
Membrane domain organizationProtein co-localization studiesPearson's correlation coefficientPermutation tests

When designing experiments, researchers should:

  • Include appropriate genetic controls (wild-type, known casp mutants, complementation lines)

  • Perform time-course analyses to capture developmental dynamics

  • Test multiple growth conditions to identify condition-specific phenotypes

  • Use quantitative image analysis for objective measurements

  • Apply appropriate statistical tests with sufficient biological and technical replicates

For barrier function analysis, which may be relevant based on the role of other CASP proteins, researchers should adapt techniques developed for Casparian strip analysis, such as tracking the movement of fluorescent tracers or measuring electrical resistance across tissue layers .

How do you troubleshoot expression issues with recombinant At1g79780?

Expression of membrane proteins like At1g79780 often presents challenges. Common issues and troubleshooting approaches include:

  • Low expression levels:

    • Optimize codon usage for the expression host

    • Test different promoters and induction conditions

    • Use fusion partners known to enhance solubility (MBP, SUMO, Trx)

    • Screen multiple colonies/clones for expression variability

  • Protein aggregation:

    • Lower induction temperature (16-20°C)

    • Reduce inducer concentration

    • Include chemical chaperones in growth media

    • Test different cell lysis and membrane solubilization conditions

  • Poor membrane extraction:

    • Screen multiple detergents (DDM, LDAO, FC-12)

    • Optimize detergent:protein ratio

    • Use gentler extraction methods (sonication vs. French press)

    • Test detergent mixtures for synergistic effects

  • Degradation during purification:

    • Include protease inhibitors throughout the purification process

    • Reduce purification temperature (4°C)

    • Minimize purification time with efficient workflows

    • Test protein stabilizing additives (glycerol, specific lipids)

Studies with membrane proteins have shown that even small changes in expression conditions can significantly impact protein yield and quality. For At1g79780, researchers should be prepared to screen many conditions in small-scale tests before scaling up to production quantities.

How can contradictory results in At1g79780 research be reconciled?

When faced with contradictory results in At1g79780 research, consider the following systematic approach to reconciliation:

  • Methodological differences:

    • Examine differences in experimental systems (in vitro vs. in vivo)

    • Compare protein constructs (full-length vs. domains, tag positions)

    • Evaluate detection methods (antibody specificity, fluorescent tag interference)

    • Consider temporal aspects (developmental stage, induction timing)

  • Genetic background effects:

    • Assess ecotype/accession differences in Arabidopsis studies

    • Examine potential genetic modifiers in different backgrounds

    • Check for unintended off-target effects in mutant lines

    • Consider redundancy with other CASPL family members

  • Environmental variables:

    • Compare growth conditions (light, temperature, media composition)

    • Assess stress level differences between studies

    • Evaluate microbiome effects in soil-grown plants

    • Consider circadian or seasonal effects on protein function

  • Data interpretation:

    • Reanalyze raw data using standardized methods

    • Apply appropriate statistical tests with sufficient power

    • Consider alternative hypotheses that reconcile divergent findings

    • Design crucial experiments to directly test competing models

Research with CASP proteins has revealed complex phenotypes that depend on genetic redundancy, environmental conditions, and developmental timing . For At1g79780, researchers should be particularly attentive to potential functional overlap with other CASPL family members, which may mask phenotypes in single mutants. Collaborative approaches and data sharing can help resolve contradictions through combined analysis of multiple datasets.

What are the most promising future research directions for At1g79780?

Based on current understanding of CASP-like proteins, promising research directions for At1g79780 include:

  • Structural biology approaches:

    • Cryogenic electron microscopy to determine protein structure

    • Molecular dynamics simulations to understand membrane interactions

    • Structure-function analysis through targeted mutagenesis

  • Systems biology integration:

    • Network analysis of At1g79780 in membrane organization pathways

    • Multi-omics integration to identify regulatory networks

    • Comparative analysis across tissues and developmental stages

  • Applied research potential:

    • Engineering membrane domain organization for enhanced stress resistance

    • Modifying barrier properties for improved nutrient use efficiency

    • Using knowledge of membrane domain formation for biotechnology applications

The evolutionary conservation of CASP-like proteins suggests they play fundamental roles in plant cell biology . Research on At1g79780 will contribute to our understanding of how plants organize their plasma membranes and cell walls, processes that are critical for adaptation to environmental challenges and optimization of resource acquisition. As technologies for membrane protein analysis continue to improve, our understanding of At1g79780 function will deepen, potentially revealing new principles of plant cell organization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.