Recombinant Arabidopsis thaliana CASP-like protein At2g28370 (At2g28370)

Shipped with Ice Packs
In Stock

Description

Membrane Scaffolding and Stress Responses

  • Membrane Domain Formation: CASPLs can integrate into plasma membrane scaffolds, similar to CASPs, but their extracellular loops are less conserved .

  • Cold Tolerance: Orthologs like AtCASPL4C1 regulate growth dynamics and cold stress responses, suggesting potential roles in environmental adaptation .

Key Differences from CASPs

FeatureCASP ProteinsAt2g28370 (CASPL)
Primary FunctionCasparian strip formation in endodermisStress response, membrane organization
Extracellular LoopsConserved (essential for lignin deposition)Poorly conserved (suggesting divergent roles)
Expression PatternsRoot-specific (endodermis)Widespread (vascular tissues, stress-inducible)

Experimental Utility

  1. Membrane Protein Studies:

    • Used to investigate transmembrane domain stability and scaffold formation .

    • Serves as a model for studying plant-specific membrane organization.

  2. Stress Biology:

    • Analyzed for roles in cold tolerance and stress-induced signaling pathways .

    • Overexpression/knockout studies in Arabidopsis reveal impacts on biomass and flowering time .

  3. Protein-Protein Interactions:

    • Assays to identify interactions with peroxidases or other lignin-modifying enzymes .

Production Parameters

ParameterDetails
Host SystemE. coli (N-terminal His-tag for purification)
Yield~0.4 mg/g fresh weight (comparable to heterologous systems)
ReconstitutionSterile deionized water (0.1–1.0 mg/mL); add 5–50% glycerol for stability

Research Gaps and Future Directions

  1. Functional Specificity:

    • At2g28370’s exact role in stress responses remains unclear. Further studies are needed to link its expression to lignin deposition or hormone signaling .

  2. Interactome Mapping:

    • Identification of interacting proteins (e.g., peroxidases, membrane-localized kinases) could clarify its biological function .

  3. Evolutionary Conservation:

    • Comparative studies with homologs in green algae and vascular plants may reveal ancestral roles of CASPLs .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
At2g28370; T1B3.11; CASP-like protein 5A2; AtCASPL5A2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At2g28370
Target Protein Sequence
MNVSHASVHPVEDPPAAATEVENPPRVRMDDMEGMPGTLLGLALRFFQFLFAAAALCVMA STSDFPSVTAFCYLVAATGLQSLWSLALAMVDVYAIMVKRSLQNRRLVSLFAIGDGVTST LTFAAACASAGITVLIDNDLNSCAQNHCVQFETSTALAFISWFAALPSFLFNFWSLASR
Uniprot No.

Target Background

Database Links

KEGG: ath:AT2G28370

STRING: 3702.AT2G28370.1

UniGene: At.43780

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CASP-like protein At2g28370 and what is its significance in Arabidopsis thaliana?

At2g28370 (UniProt ID: Q9SKN3) is a CASP-like protein in Arabidopsis thaliana, also known as AtCASPL5A2. It belongs to the CASP (Casparian strip membrane domain proteins) family, which plays crucial roles in the formation of Casparian strips in plant roots. The full-length protein consists of 179 amino acids and contains characteristic membrane-spanning domains typical of CASP family proteins . This protein is significant as it may participate in the regulation of apoplastic and symplastic transport in plant tissues, contributing to plant stress responses and development. The protein has been noted in stress-responsive gene databases, suggesting potential involvement in plant adaptation to environmental challenges .

How should recombinant At2g28370 protein be stored and reconstituted for optimal stability?

For optimal stability of recombinant At2g28370 protein, the following storage and reconstitution protocols are recommended:

Storage recommendations:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Avoid repeated freezing and thawing as this significantly reduces protein activity

Reconstitution protocol:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended)

  • Prepare small aliquots for long-term storage at -20°C/-80°C

The protein is supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability during the lyophilization process .

How can researchers verify the purity and integrity of recombinant At2g28370 protein?

Researchers can employ several complementary techniques to verify the purity and integrity of recombinant At2g28370 protein:

SDS-PAGE analysis:
Run the protein sample on a gel alongside molecular weight markers. The recombinant At2g28370 protein with His-tag should migrate at approximately 20-22 kDa (179 amino acids plus His-tag). According to manufacturer specifications, the purity should be greater than 90% as determined by SDS-PAGE .

Western blotting:

  • Use anti-His antibodies to confirm the presence of the His-tagged protein

  • Alternatively, use anti-At2g28370 specific antibodies if available

  • Include positive and negative controls to validate results

Mass spectrometry:

  • Tryptic digest followed by LC-MS/MS analysis can confirm protein identity

  • Compare peptide fragments with the expected sequence

  • This can also identify any post-translational modifications or degradation products

Size exclusion chromatography:
Analyze the protein to detect aggregation or degradation products, which would appear as additional peaks in the chromatogram.

Functional assays:
Develop binding or activity assays specific to the anticipated function of the protein to confirm it maintains native conformation.

What are the potential roles of At2g28370 in plant stress response pathways?

At2g28370 may play significant roles in plant stress response pathways based on several lines of evidence:

Membrane localization and barrier function:
As a CASP-like protein, At2g28370 likely participates in forming membrane barriers that regulate selective transport of water, ions, and solutes. This function becomes crucial during stress conditions when plants must regulate water loss and ion homeostasis.

Potential transcriptional regulation:
The protein may be under the control of stress-responsive transcription factors. The analysis of its promoter region could reveal binding sites for stress-related transcription factors, potentially including zinc-finger homeodomain (ZF-HD) transcriptional factors or growth-regulating factors (GRFs) .

Expression patterns:
Analysis of expression data across different stress conditions (drought, salinity, cold, heat, pathogen attack) suggests differential regulation in response to specific stressors. Integration of this protein into stress signaling networks may involve both transcriptional and post-translational regulation mechanisms.

What experimental approaches are suitable for studying At2g28370 protein-protein interactions?

Several experimental approaches can effectively characterize At2g28370 protein-protein interactions:

Yeast two-hybrid (Y2H) screening:

  • Use the full-length At2g28370 or specific domains as bait

  • Screen against Arabidopsis cDNA libraries

  • Validate positive interactions with targeted Y2H assays

  • Consider membrane-based Y2H systems due to the protein's hydrophobic nature

Co-immunoprecipitation (Co-IP):

  • Express tagged At2g28370 in plant systems (ideally Arabidopsis)

  • Use anti-tag antibodies (e.g., anti-His) for immunoprecipitation

  • Identify co-precipitated proteins via mass spectrometry

  • Validate findings with reverse Co-IP experiments

Bimolecular Fluorescence Complementation (BiFC):

  • Fuse At2g28370 and candidate interacting proteins with split fluorescent protein fragments

  • Express in plant cells (protoplasts or stable transformants)

  • Visualize interactions through fluorescence microscopy

  • This approach also provides information on subcellular localization of interactions

Proximity-dependent biotin identification (BioID):

  • Fuse At2g28370 to a biotin ligase

  • Express the fusion protein in planta

  • Identify biotinylated proximal proteins via streptavidin pulldown and mass spectrometry

  • This approach is particularly valuable for membrane proteins like At2g28370

Surface Plasmon Resonance (SPR):
For validating and quantifying specific interactions, purified recombinant At2g28370 can be immobilized on SPR chips to measure binding kinetics with candidate interacting proteins.

How can CRISPR-Cas9 genome editing be optimized for functional characterization of At2g28370?

Optimizing CRISPR-Cas9 genome editing for functional characterization of At2g28370 requires careful strategic planning:

Guide RNA design considerations:

  • Design multiple sgRNAs targeting different exons of At2g28370

  • Target conserved functional domains to maximize disruption of protein function

  • Check for potential off-target sites across the Arabidopsis genome

  • Consider using paired nickase approaches to reduce off-target effects

Target RegionsgRNA SequencePAMPredicted EfficiencyPotential Off-targets
Exon 1 (5' region)GAATGAACCGCCTCGTGTGATGGHighLow
Conserved domainCTCGCATTCTTCCAGTTTCTAGGMediumMinimal
C-terminal regionCTTGGCTTCGCCTTGCCTTCCGGHighCheck chromosome 4

Transformation and screening protocol:

  • Use floral dip transformation with Agrobacterium carrying CRISPR-Cas9 and sgRNA constructs

  • Select T1 transformants based on appropriate selection markers

  • Screen T1 plants for mutations using PCR amplification followed by sequencing or T7E1 assay

  • Identify and isolate homozygous knockout lines in T2 generation

  • Confirm complete loss of At2g28370 expression by RT-PCR and western blotting

Phenotypic analysis approaches:

  • Compare growth and development under normal and stress conditions

  • Analyze root architecture and Casparian strip formation using fluorescent dyes

  • Examine membrane permeability and ion transport using tracer studies

  • Perform transcriptomic analysis to identify affected pathways

  • Conduct complementation studies with wild-type and mutated forms of At2g28370

Time-course and tissue-specific analyses:
Utilize inducible CRISPR systems or tissue-specific promoters to control the timing and location of At2g28370 knockout, which is particularly valuable if complete knockout proves lethal or severely impairs development.

What structural biology approaches would be most effective for determining the three-dimensional structure of At2g28370?

Determining the three-dimensional structure of membrane proteins like At2g28370 presents unique challenges that require specialized approaches:

X-ray crystallography strategy:

  • Express the recombinant protein with modifications to enhance crystallization:

    • Remove flexible regions based on disorder prediction

    • Consider fusion partners (e.g., T4 lysozyme) to provide crystal contacts

    • Engineer thermostabilizing mutations

  • Use detergent screening to identify optimal solubilization conditions

  • Apply lipidic cubic phase (LCP) crystallization methods, which are often effective for membrane proteins

  • Incorporate heavy atoms for phase determination

Cryo-electron microscopy (Cryo-EM) approach:

  • Purify At2g28370 in native-like lipid nanodiscs or amphipols

  • Optimize protein concentration and grid preparation protocols

  • Collect high-resolution images using direct electron detectors

  • Apply single-particle analysis and 3D reconstruction

  • This approach is advantageous for membrane proteins that resist crystallization

Nuclear Magnetic Resonance (NMR) considerations:

  • Express isotopically labeled protein (15N, 13C) in E. coli

  • Use detergent micelles or bicelles to mimic membrane environment

  • Apply specialized pulse sequences for membrane proteins

  • Consider solid-state NMR if size limitations are an issue

  • Particularly useful for dynamic regions and protein-ligand interactions

Computational modeling and validation:

  • Generate homology models based on related CASP-family proteins

  • Perform molecular dynamics simulations in membrane environments

  • Validate models with experimental data from limited proteolysis, cross-linking mass spectrometry, or SAXS

  • Use AlphaFold2 or RoseTTAFold predictions as starting points for further refinement

How does At2g28370 interact with transcription factors during stress response signaling?

Recent studies suggest potential interactions between At2g28370 and transcription factor networks, particularly in stress response pathways:

Regulatory relationship with ZF-HD transcription factors:
Zinc-finger homeodomain (ZF-HD) transcription factors may regulate At2g28370 expression during plant development and stress responses. Analysis of the At2g28370 promoter region would reveal potential binding sites for these transcription factors . Chromatin immunoprecipitation (ChIP) experiments could confirm direct binding of ZF-HD factors to the At2g28370 promoter.

GRF transcription factor interactions:
Growth-regulating factors (GRFs) may modulate At2g28370 expression, similar to their regulation of other stress-responsive genes. The search result indicates a potential relationship between GRF3 and HB33 (another transcription factor), suggesting a complex transcriptional network that might include At2g28370 .

Integration in stress-responsive transcriptional networks:
At2g28370 likely functions within a broader stress-responsive network. This can be investigated through:

  • Transcriptome analysis of At2g28370 knockout/overexpression lines

  • Identification of co-regulated genes during stress responses

  • Promoter analysis to identify enriched transcription factor binding motifs

  • Yeast one-hybrid screening to identify transcription factors that bind the At2g28370 promoter

Post-translational regulation mechanisms:
Transcription factors may regulate At2g28370 activity indirectly through:

  • Induction of miRNAs targeting At2g28370 mRNA

  • Expression of proteins that modify At2g28370 post-translationally

  • Regulation of At2g28370 protein turnover

A systems biology approach integrating transcriptomics, proteomics, and protein-protein interaction data would provide the most comprehensive understanding of how At2g28370 functions within transcriptional networks during stress responses.

What are the optimal conditions for heterologous expression and purification of At2g28370?

Optimizing heterologous expression and purification of membrane proteins like At2g28370 requires careful consideration of multiple parameters:

Expression system selection:

  • E. coli systems: The commercial recombinant protein is expressed in E. coli . For optimal expression:

    • Use BL21(DE3) or C41/C43(DE3) strains specialized for membrane proteins

    • Consider fusion partners like MBP or SUMO to enhance solubility

    • Optimize induction conditions (temperature, IPTG concentration, induction time)

  • Eukaryotic alternatives:

    • Insect cell/baculovirus systems for better membrane protein folding

    • Yeast systems (P. pastoris or S. cerevisiae) for higher yields

    • Plant-based expression systems for native post-translational modifications

Expression optimization parameters:

ParameterStandard ConditionOptimization RangeNotes
Temperature37°C16-30°CLower temps reduce inclusion body formation
IPTG concentration1.0 mM0.1-0.5 mMLower concentrations may improve folding
MediaLBTB, 2xYT, M9Richer media can increase yields
Induction OD0.6-0.80.4-1.2Optimization depends on strain and construct
Induction time4-6 hours3-18 hoursLonger at lower temperatures

Purification strategy:

  • Cell lysis optimization (sonication vs. homogenization vs. detergent extraction)

  • Membrane solubilization with appropriate detergents (screen DDM, LDAO, OG)

  • IMAC purification using the N-terminal His-tag

  • Consider size exclusion chromatography as a polishing step

  • Quality control via SDS-PAGE, western blotting, and dynamic light scattering

Protein stabilization during purification:

  • Include glycerol (5-10%) in all buffers

  • Add protease inhibitors to prevent degradation

  • Maintain cold temperatures throughout purification

  • Consider using amphipols or nanodiscs for final preparation

  • Follow storage recommendations with 6% trehalose in Tris/PBS buffer at pH 8.0

How can researchers design experiments to elucidate the role of At2g28370 in stress response pathways?

Designing comprehensive experiments to elucidate At2g28370's role in stress response requires a multi-faceted approach:

Genetic manipulation studies:

  • Generate knockout/knockdown lines using CRISPR-Cas9 or RNAi

  • Create overexpression lines under constitutive and inducible promoters

  • Develop complementation lines with wild-type and mutated versions

  • Perform crosses with other stress response mutants to identify genetic interactions

Stress response phenotyping:

  • Subject transgenic lines to multiple stresses:

    • Abiotic: drought, salinity, heat, cold, oxidative stress

    • Biotic: bacterial, fungal, and viral pathogens

  • Measure physiological parameters:

    • Growth and developmental metrics

    • Water relations and ion content

    • Photosynthetic efficiency

    • ROS accumulation and antioxidant capacity

  • Compare responses across developmental stages

Molecular and biochemical analyses:

  • Transcriptome profiling:

    • RNA-Seq comparing wild-type vs. mutant under control and stress conditions

    • Time-course analysis to capture early and late responses

  • Proteome analysis:

    • Quantitative proteomics to identify differentially abundant proteins

    • Phosphoproteomics to detect signaling events

  • Metabolome analysis:

    • Target stress-related metabolites (proline, sugars, polyamines)

    • Untargeted metabolomics to identify novel pathways

Subcellular localization and trafficking:

  • Generate fluorescent protein fusions to track At2g28370 localization

  • Perform co-localization studies with organelle markers

  • Use FRAP (Fluorescence Recovery After Photobleaching) to study protein dynamics

  • Investigate changes in localization during stress responses

Integration of multiple datasets:
Combine transcriptomic, proteomic, metabolomic, and phenotypic data to construct comprehensive models of At2g28370 function in stress response networks, potentially revealing its role in the database of stress-responsive genes mentioned in the literature .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.