Recombinant Arabidopsis thaliana CASP-like protein At2g35760 (At2g35760)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Arabidopsis thaliana CASP-Like Protein At2g35760 (At2g35760)

The recombinant Arabidopsis thaliana CASP-like protein At2g35760 is a bioengineered version of the endogenous protein encoded by the At2g35760 gene. This protein belongs to the Uncharacterized Protein Family (UPF0497) and is associated with the CASP (Casparian Strip Membrane Domain) protein family, which plays roles in membrane domain organization and plant development . The recombinant form is produced for research purposes, typically expressed in E. coli with modifications such as N-terminal His-tag fusion to facilitate purification .

Recombinant Production and Applications

The protein is synthesized via bacterial expression systems, primarily E. coli, with post-translational modifications limited to the His-tag . Key production parameters include:

ParameterDetails
Host OrganismE. coli (common), yeast, or mammalian cells (alternative systems)
TagN-terminal His-tag
FormLyophilized powder or glycerol-stabilized liquid
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
Stability-20°C/-80°C for long-term storage; avoid freeze-thaw cycles

This recombinant protein is primarily used in biochemical assays and functional studies to explore its role in membrane organization, plant stress responses, or interactions with other CASP family members .

Challenges and Future Directions

Key gaps in current knowledge include:

  • Functional Annotation: Limited experimental data on At2g35760’s biochemical activity or interactions.

  • Localization: Plasma membrane localization (predicted) requires validation via fluorescence tagging.

  • Evolutionary Context: Phylogenetic analysis could clarify its relationship to other CASP subfamilies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
At2g35760; T20F21.5; CASP-like protein 2B2; AtCASPL2B2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At2g35760
Target Protein Sequence
MSYLGVGVSPGNVSGSTTKMKLIDRKVRVTELILRCLVCVLALVAAILIATDVQVREIFM IQKKAKFTDMKALVLLVVVNGIAAGYSLVQAVRCVVGLMKGRVLFSKPLAWAIFFGDQAV AYLCVAGVAAAAQSAAFAKLGEPELQWMKICNMYGKFCNQVGEGIASALFACIGMVLISC ISAFGVFRLYGGSKSRPSSRW
Uniprot No.

Target Background

Database Links

KEGG: ath:AT2G35760

UniGene: At.28259

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural classification of At2g35760 within the CASP-like protein family?

At2g35760 belongs to the CASP (Casparian Strip membrane domain) protein family (UPF0497) in Arabidopsis thaliana. This family consists of approximately 39 genes organized into 6 subfamilies based on phylogenetic analysis. Like other CASP-like proteins, At2g35760 is predicted to have multiple transmembrane domains, typically four, that anchor it to the plasma membrane. The protein contains conserved regions characteristic of the UPF0497 family, though its specific subfamily classification may differ from AtCASPL4C1 (At3g55390) .

How does At2g35760 relate to other characterized CASP-like proteins?

While At2g35760 is less extensively studied than some CASP family members, comparative analysis shows it shares structural features with other CASP-like proteins. The core CASP family members (CASP1-5) are known to mediate Casparian strip formation in the endodermis, but numerous CASP-like proteins, including potentially At2g35760, may have functions beyond Casparian strip formation. Phylogenetic analysis is recommended to determine its closest relatives within the family, which would provide insights into potential functional similarities .

What techniques are most effective for predicting transmembrane domains in At2g35760?

For accurate transmembrane domain prediction in At2g35760, researchers should use multiple TM prediction programs for consensus analysis, similar to the approach used for other CASP-like proteins. Based on studies of related proteins such as ClCASPL and AtCASPL4C1, which contain four transmembrane domains, researchers should anticipate a similar structure in At2g35760. Programs such as TMHMM, Phobius, and MEMSAT are recommended, with consensus results from multiple algorithms providing the most reliable predictions .

What expression patterns would be expected for At2g35760 based on other CASP-like proteins?

Based on studies of other CASP-like proteins, At2g35760 might show tissue-specific expression patterns with potential prominence in vascular tissues. For example, AtCASPL4C1 (At3g55390) is widely expressed across various organs and is not limited to roots where Casparian strips form. To determine At2g35760's specific expression pattern, researchers should conduct GUS reporter assays using the At2g35760 promoter region (approximately 1.5-2kb upstream of the start codon) fused to the β-glucuronidase gene. This approach, similar to that used for AtCASPL4C1, would enable visualization of expression across different tissues and developmental stages .

How should researchers investigate At2g35760 expression under stress conditions?

To investigate At2g35760 expression under stress conditions:

  • Design qPCR primers specific to At2g35760, avoiding cross-reactivity with other CASP family members

  • Subject plants to various stress treatments (cold, drought, heat, pathogen)

  • Collect tissue samples at multiple time points (e.g., 0, 6, 12, 24, 48 hours after treatment)

  • Extract RNA and perform RT-qPCR analysis using appropriate reference genes

  • Alternatively, create transgenic plants with the At2g35760 promoter driving GUS expression and measure GUS activity under different stress conditions

Based on findings with AtCASPL4C1, which shows peak expression 48 hours after cold treatment, At2g35760 may also exhibit stress-responsive expression patterns with potential differences in timing and magnitude .

What is the predicted subcellular localization of At2g35760 and how can it be confirmed experimentally?

At2g35760, like other CASP-like proteins, is predicted to localize to the plasma membrane. To confirm this experimentally:

  • Create a fusion protein with At2g35760 and GFP (either N- or C-terminal fusion)

  • Express this construct in Arabidopsis protoplasts or stable transgenic plants

  • Visualize using confocal microscopy

  • Use membrane-specific dyes (e.g., FM4-64) as co-localization markers

  • Include plasma membrane, endoplasmic reticulum, and tonoplast markers for comparative analysis

This approach has successfully determined the plasma membrane localization of other CASP-like proteins such as ClCASPL .

What are the optimal methods for generating recombinant At2g35760 protein for in vitro studies?

For generating recombinant At2g35760:

  • Clone the At2g35760 coding sequence into an appropriate expression vector (e.g., pET series for E. coli or pFastBac for insect cells)

  • Consider adding a solubility tag (MBP, SUMO, or GST) to improve solubility of this membrane protein

  • For membrane proteins like At2g35760, insect cell or cell-free expression systems often yield better results than E. coli

  • Use mild detergents (e.g., DDM, LMNG) for extraction and purification

  • Verify protein integrity by SDS-PAGE and western blotting

  • Consider using a fusion tag system that allows for tag removal post-purification

For functional studies, it's important to confirm that the recombinant protein maintains its native conformation, particularly challenging for membrane proteins like CASP-like proteins.

How should researchers design knockout and overexpression studies for At2g35760?

For knockout studies:

  • Obtain T-DNA insertion lines from repositories like NASC or ABRC

  • Verify the insertion location by genotyping PCR

  • Confirm knockout status by RT-PCR and/or western blotting

  • Generate complementation lines to verify phenotypes are due to the knockout

For overexpression studies:

  • Clone At2g35760 under a constitutive promoter (e.g., 35S) or inducible promoter

  • Transform Arabidopsis using floral dip method

  • Select multiple independent transgenic lines

  • Verify overexpression by qRT-PCR and western blotting

  • Characterize phenotypes under normal and stress conditions

In both cases, researchers should be aware of potential functional redundancy with other CASP family members, which might mask phenotypes in single gene manipulations .

What phenotyping approaches would be most informative when studying At2g35760 mutants?

Based on knowledge of other CASP-like proteins, researchers should conduct comprehensive phenotyping including:

Phenotyping CategorySpecific MeasurementsRelevance
Growth parametersPrimary root length, lateral root development, rosette diameter, biomass, flowering timeAtCASPL4C1 knockouts show faster growth, increased biomass, and earlier flowering
Stress toleranceCold stress (10°C exposure), measurement of chlorophyll fluorescence parameters, survival ratesCASP-like proteins have been implicated in cold tolerance
Vascular developmentCross-sectional analysis of stems and roots, vascular patterningCASP-like proteins may have roles in vascular tissue beyond Casparian strip
Casparian strip integrityLignin staining in roots, apoplastic tracer penetration assaysTo determine if At2g35760 affects Casparian strip formation
Gene expressionqRT-PCR of related CASP genes to detect compensatory expressionRelated CASP genes show altered expression in other CASP mutants

These approaches would provide a comprehensive view of At2g35760 function across different developmental stages and conditions .

How can researchers distinguish between direct and indirect effects when studying At2g35760 function?

To distinguish between direct and indirect effects:

  • Generate inducible knockout or overexpression lines using systems like DEX-inducible or estradiol-inducible promoters

  • Perform time-course experiments following induction to separate early (likely direct) effects from later (potentially indirect) effects

  • Combine with transcriptomics to identify immediate transcriptional changes

  • Utilize protein-protein interaction studies (Y2H, BiFC, or co-IP) to identify direct interaction partners

  • Create point mutations in functional domains rather than complete knockouts to distinguish specific functions

  • Cross-reference phenotypic observations with expression data to correlate effects with At2g35760 expression levels

This approach helps mitigate the challenge of interpreting complex developmental phenotypes that might involve multiple downstream pathways .

What is the predicted role of At2g35760 in abiotic stress responses based on other CASP-like proteins?

Based on studies of related CASP-like proteins, At2g35760 may play a role in abiotic stress responses, particularly cold stress. AtCASPL4C1 (At3g55390) has been shown to negatively regulate cold tolerance, with knockout plants displaying enhanced cold tolerance. Researchers investigating At2g35760 should:

  • Examine expression patterns under various abiotic stresses (cold, drought, salt, heat)

  • Monitor physiological parameters in knockout/overexpression lines under stress conditions

  • Measure ROS levels, membrane integrity, and osmolyte accumulation under stress

  • Compare transcriptomic responses between wild-type and mutant plants under stress

  • Investigate potential crosstalk with known stress response pathways (ABA, DREB, etc.)

The negative regulation of stress tolerance observed in AtCASPL4C1 suggests that some CASP-like proteins may function as stress response modulators rather than direct protective factors .

How do researchers address functional redundancy issues when studying At2g35760?

Functional redundancy is a significant challenge when studying CASP-like proteins. To address this:

  • Generate higher-order mutants by crossing At2g35760 knockout with mutants of phylogenetically close CASP-like genes

  • Use CRISPR/Cas9 to create multiplex knockouts of closely related family members

  • Perform complementation studies with various CASP-like genes to test functional equivalence

  • Conduct detailed expression analysis to identify co-expressed CASP-like genes

  • Use artificial microRNA approaches to simultaneously silence multiple family members

  • Analyze expression changes of other CASP family members in At2g35760 mutants to detect compensatory regulation

Studies of CASP1-5 have shown that single mutants often display minimal phenotypes while double mutants show more pronounced effects, suggesting functional redundancy within the family .

How should researchers interpret contradictory results between At2g35760 and other CASP-like proteins?

When facing contradictory results:

  • Consider the evolutionary distance between the compared CASP-like proteins within the phylogenetic tree

  • Examine expression patterns and tissue specificity differences

  • Account for different genetic backgrounds used in various studies

  • Evaluate methodological differences that might impact results

  • Consider potential species-specific functions if comparing orthologs

  • Analyze protein interaction networks that might differ between family members

For example, while AtCASPL4C1 knockout enhances cold tolerance, other CASP-like proteins might have different or even opposing functions depending on their specific roles in particular tissues or developmental stages .

What approaches can resolve data inconsistencies in CASP-like protein research?

To resolve inconsistencies in research data:

  • Standardize experimental conditions across studies (growth conditions, stress treatments, etc.)

  • Use multiple alleles or independent transgenic lines to confirm phenotypes

  • Employ complementary techniques to verify findings (e.g., both transcriptomic and proteomic approaches)

  • Conduct time-course experiments to capture dynamic responses

  • Consider tissue-specific analyses rather than whole-plant studies

  • Develop in vitro assays to test specific biochemical functions

  • Use computational modeling to integrate disparate datasets and generate testable hypotheses

One challenge specifically noted with CASP-like proteins is that their roles may extend beyond Casparian strip formation, necessitating broader experimental approaches to fully characterize their functions .

How can researchers distinguish between Casparian strip-related and unrelated functions of At2g35760?

To distinguish between Casparian strip-related and unrelated functions:

  • Perform detailed lignin staining of the endodermis in roots of At2g35760 mutants

  • Measure suberin deposition in mutant roots

  • Use apoplastic tracers to assess barrier function in the endodermis

  • Examine expression in tissues lacking Casparian strips

  • Compare phenotypes with known Casparian strip mutants (e.g., casp1/casp3 double mutants)

  • Investigate protein localization in various cell types, not just the endodermis

  • Analyze the impact on growth and development beyond root architecture

Research on AtCASPL4C1 has shown that despite being part of the CASP family, it did not significantly affect Casparian strip formation in roots while still impacting plant growth and stress responses, suggesting broader functions for some CASP-like proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.