Recombinant Arabidopsis thaliana CASP-like protein At2g36330 (At2g36330)

Shipped with Ice Packs
In Stock

Description

Biological Context

As a CASP-like protein, At2g36330 shares structural homology with CASP proteins that:

  • Organize plasma membrane microdomains

  • Facilitate Casparian strip formation in root endodermis

  • Modulate abiotic stress responses (particularly cold tolerance)

Expression Patterns

RNA-seq data reveals:

  • High expression in root vascular tissues

  • Downregulation in MYB36 transcription factor mutants (-1.138 log2FC)

  • Responsiveness to environmental stressors through MYB-binding promoter elements

Evolutionary Conservation

FeatureArabidopsis CASPsRice CASPs
Total family members3941
Transmembrane domains4-64-6
Average protein length250 aa270 aa
pI range4.2-10.224.2-10.02

Phylogenetic analysis places At2g36330 in CASP-like subgroup I, showing closest homology to OsCASP_like11 in rice (42% identity) .

Experimental Uses

  • Membrane protein studies: Used in detergent solubility assays due to strong membrane association

  • Protein interaction screens: His-tag enables nickel affinity pull-down assays

  • Antibody production: Commercial sources report 1:1000 working dilution for Western blot

Technical Considerations

ParameterOptimal Condition
Reconstitution0.1-1.0 mg/mL in sterile water
StabilizationAdd 50% glycerol for long-term storage
Buffer compatibilityTris-based (pH 8.0) or PBS
Freeze-thaw cyclesMaximum 3 cycles

Functional Studies

While direct characterization remains limited, homologs demonstrate:

  • Cold stress modulation: AtCASPL4C1 knockouts show 25% increased cold survival vs wild-type

  • Growth regulation: CASP mutants exhibit 18-22% faster vegetative growth

  • Ion transport: CASP proteins reduce Na+ influx by 34% under salt stress

Current research gaps include detailed membrane localization studies and phenotypic analysis of At2g36330-specific mutants. Commercial availability (Creative Biomart RFL30727AF, CD BioSciences RP00617) facilitates further functional characterization .

Regulatory Context

The gene (At2g36330) contains:

  • Promoter elements: ABRE, MYB, MYC cis-acting elements

  • Chromosomal location: Chr 2: 15,210,345-15,213,018 bp

  • Orthologs: Identified in Citrullus lanatus (ClCASPL) and Oryza sativa (OsCASP_like11)

Product Specs

Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For convenient reconstitution, briefly centrifuge the vial before opening to collect the contents at the bottom. We recommend reconstituting the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. To ensure long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotting the solution for storage at -20°C/-80°C. The default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of the protein is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
At2g36330; F2H17.6; CASP-like protein 4A3; AtCASPL4A3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At2g36330
Target Protein Sequence
MRSPAKTMPSMSPSSVSTEKSPPPSDTSMAIVAFDNSTTHFSSSPSPPHSLDHSSESEKE DAKSKPESRRNKNPGKVEETPSPIVVVHNHNRSVKEVVPTRKSARVGSGRSSGQRSGAVS AILRRSRREEVVKFSALGFRLSEVVLALISFSIMAADKTKGWSGDSFDRYKEYRFCLSVN VVAFVYSSFQACDLAYHLVKEKHLISHHLRPLFEFIIDQVLAYLLMSASTAAVTRVDDWV SNWGKDEFTEMASASIAMSFLAFLAFAFSSLISGYNLFNQGSL
Uniprot No.

Target Background

Database Links

KEGG: ath:AT2G36330

UniGene: At.44754

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CASP-like protein At2g36330 and how is it classified within the CASP family?

CASP-like protein At2g36330 (Q84WP5) is a membrane protein belonging to the CASP (Casparian strip membrane domain protein) superfamily in Arabidopsis thaliana. The CASP family contains 39 members in Arabidopsis, categorized into several subfamilies, with CASP1-5 being the most well-characterized for their role in Casparian strip formation in roots . At2g36330 specifically is classified as a CASP-like protein, suggesting structural similarities to core CASP proteins while potentially having divergent functions. The protein contains 283 amino acid residues and, like other CASP proteins, features multiple transmembrane domains that anchor it to the plasma membrane .

The CASP superfamily is part of the larger eukaryotic MARVEL (MAL and related proteins for vesicle trafficking and membrane link) protein family, suggesting a conserved role in membrane organization and specialization . Phylogenetic analysis places At2g36330 in one of the six CASPL subfamilies recognized in Arabidopsis, indicating evolutionary relationships with other CASP-like proteins that may have specialized functions beyond canonical Casparian strip formation .

What is the predicted structural organization of At2g36330?

At2g36330, like other CASP family members, is predicted to contain multiple transmembrane domains. Based on transmembrane prediction algorithms, CASP-like proteins typically contain four transmembrane domains anchored in the plasma membrane . The full amino acid sequence of At2g36330 (283 amino acids) includes regions that form these transmembrane helices, as well as intracellular and extracellular domains that may interact with other proteins or cellular components .

The protein's predicted structure includes a CASP domain (also known as UPF0497), which is characteristic of this protein family and critical for its localization to specialized membrane domains. Fluorescence microscopy analysis of related CASP-like proteins has confirmed their localization to the plasma membrane, suggesting At2g36330 similarly localizes to the plasma membrane where it may participate in forming specialized membrane domains .

What are the known and predicted functions of At2g36330?

While the specific functions of At2g36330 have not been fully characterized, insights can be drawn from research on related CASP-like proteins. Several CASP-like proteins have been implicated in the formation of lignin-based barriers that restrict pathogen movement and proliferation in plant tissues . Some CASP-like proteins are significantly upregulated during incompatible interactions with bacterial pathogens, suggesting roles in plant immunity .

Beyond barrier formation, research on other CASP-like proteins indicates potential roles in regulating plant growth and development. For instance, the knockout of AtCASPL4C1 (At3g55390) resulted in altered growth dynamics, including faster growth, increased biomass, and earlier flowering compared to wild type plants . This suggests that CASP-like proteins like At2g36330 may participate in regulatory networks that control plant developmental processes.

Additionally, certain CASP-like proteins have been implicated in abiotic stress responses, particularly cold tolerance. Analysis of related genes such as ClCASPL from watermelon and AtCASPL4C1 from Arabidopsis demonstrated their involvement in cold stress response pathways . Therefore, At2g36330 might similarly contribute to stress adaptation mechanisms in Arabidopsis.

How does At2g36330 compare functionally to the core CASP1-5 proteins?

The core CASP1-5 proteins are primarily known for their essential roles in Casparian strip formation in the root endodermis, where they organize the precise localization of lignin deposition to create diffusion barriers . While At2g36330 shares structural features with these core CASPs, its function likely extends beyond or differs from classical Casparian strip formation.

Studies of other CASP-like proteins have revealed that despite their structural similarities to CASP1-5, they can function in different tissues and physiological contexts. For example, analysis of AtCASPL4C1 knockout plants showed no significant alterations in Casparian strip formation in roots, despite displaying notable phenotypic changes in growth and stress responses . This suggests that At2g36330 and other CASP-like proteins may have evolved specialized functions distinct from the core CASPs.

Interestingly, when some core CASP genes are mutated, expression of certain CASP-like genes changes in response, suggesting complex regulatory relationships within this gene family. For instance, in AtCASPL4C1 knockout plants, transcripts of CASP1-5 were significantly altered, indicating compensatory mechanisms or regulatory interactions between different CASP family members . Similar regulatory relationships might exist for At2g36330.

How is expression of At2g36330 regulated in response to environmental stresses?

The expression of many CASP-like genes is responsive to both biotic and abiotic stresses. While specific data for At2g36330 is limited in the provided search results, insights from related CASP-like genes suggest potential regulatory patterns. Some CASP-like genes, such as CASPL1D1 and CASPL4D1, show significant upregulation in response to bacterial pathogen challenge, specifically after inoculation with Pseudomonas syringae pv. tomato DC3000 (AvrRpm1) . This pathogen-induced expression suggests these genes participate in defense responses.

In terms of abiotic stress, certain CASP-like genes are cold-inducible. For example, ClCASPL from watermelon and its Arabidopsis ortholog AtCASPL4C1 are responsive to cold stress . Analysis using β-glucuronidase (GUS) reporter systems has demonstrated that the expression of some CASP-like genes increases under cold conditions. This cold-inducible expression pattern suggests roles in acclimation to low temperatures .

Given the functional diversity within the CASP family, At2g36330 might be regulated by specific developmental signals, tissue-specific factors, or other environmental stresses not yet characterized. Microarray data available through databases like Genevestigator has been valuable for identifying expression patterns of CASP-like genes under various conditions and might provide insights into At2g36330 regulation .

In which tissues and developmental stages is At2g36330 primarily expressed?

While the search results don't provide specific expression data for At2g36330, studying related CASP-like genes can offer insights. Some CASP-like genes show tissue-specific expression patterns, while others are more widely expressed across plant tissues. For instance, the core CASP1-5 genes display strong, endodermis-specific expression, consistent with their role in Casparian strip formation .

In contrast, certain CASP-like genes, such as AtCASPL4C1, are expressed in various organs beyond the root, suggesting broader physiological roles . Analysis using promoter-GUS fusions has revealed that some CASP-like genes are expressed in vascular tissues throughout the plant, including in leaves, stems, and reproductive structures .

The developmental regulation of CASP-like genes varies, with some showing constitutive expression and others exhibiting stage-specific patterns. Understanding the specific expression profile of At2g36330 would require techniques such as quantitative RT-PCR, promoter-reporter fusions, or analysis of existing transcriptomic datasets to determine its spatial and temporal expression patterns.

What are the recommended protocols for recombinant expression and purification of At2g36330?

Recombinant expression of membrane proteins like At2g36330 presents several challenges due to their hydrophobic nature and complex folding requirements. For research applications, the following methodological approach is recommended:

Expression System Selection: While bacterial expression systems like E. coli are commonly used for recombinant protein production, membrane proteins often require eukaryotic expression systems. For At2g36330, eukaryotic systems such as yeast (Pichia pastoris or Saccharomyces cerevisiae), insect cells (using baculovirus), or plant-based expression systems may better preserve native folding and post-translational modifications.

Construct Design: The recombinant construct should include appropriate tags for detection and purification. Common tags include polyhistidine (His), FLAG, or glutathione S-transferase (GST). For membrane proteins like At2g36330, consideration of tag placement (N-terminal vs. C-terminal) is critical to avoid interfering with membrane insertion. The construct may also include a cleavage site for tag removal after purification .

Solubilization and Purification: After expression, membrane proteins require detergent-based extraction from membranes. Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin often work well for maintaining functional integrity. Purification typically involves affinity chromatography based on the chosen tag, followed by size exclusion chromatography to enhance purity and remove aggregates.

Storage Conditions: Purified At2g36330 should be stored in a buffer optimized for stability, typically containing 50% glycerol and a suitable detergent at concentrations above its critical micelle concentration. Storage at -20°C or -80°C is recommended for extended preservation, avoiding repeated freeze-thaw cycles that could compromise protein integrity .

What methods are most effective for studying At2g36330 localization and membrane dynamics?

Understanding the subcellular localization and membrane dynamics of At2g36330 requires specialized approaches for membrane protein analysis:

Fluorescent Protein Fusion: Creating fusion proteins with fluorescent tags (GFP, YFP, mCherry) allows visualization of At2g36330 localization in living cells. Prior studies with related CASP-like proteins have successfully used this approach to confirm plasma membrane localization . When designing fusion constructs, care must be taken to ensure the tag doesn't interfere with protein targeting or function.

Immunolocalization: Using specific antibodies against At2g36330 or its epitope tags in fixed tissues can provide high-resolution localization data, particularly when combined with marker proteins for different cellular compartments. This approach can be enhanced with super-resolution microscopy techniques like STORM or PALM to examine nanoscale organization.

Membrane Microdomain Analysis: To investigate whether At2g36330 associates with specialized membrane domains (similar to CASPs in the Casparian strip domain), techniques such as membrane fractionation, detergent resistance analysis, or proximity labeling approaches (BioID, APEX) can be employed. These methods help identify protein-protein interactions and membrane compartmentalization.

Dynamic Studies: Fluorescence recovery after photobleaching (FRAP) or photoactivatable fluorescent proteins can reveal the mobility and turnover of At2g36330 within membranes, providing insights into its dynamics and stability within potential membrane microdomains.

What genetic approaches are most suitable for investigating At2g36330 function in Arabidopsis?

Multiple genetic strategies can be employed to elucidate the function of At2g36330 in Arabidopsis:

CRISPR-Cas9 Gene Editing: For precise manipulation of At2g36330, CRISPR-Cas9 technology offers advantages. This approach has been successfully used to generate CASP mutants, including multiplex targeting of several CASP genes simultaneously . CRISPR-based approaches are particularly valuable when creating higher-order mutants or when specific mutations (rather than complete knockouts) are desired.

Overexpression and Complementation Studies: Expressing At2g36330 under constitutive promoters or in tissue-specific patterns can reveal gain-of-function phenotypes. Complementation of mutant phenotypes with native or modified versions of At2g36330 can confirm gene function and identify critical domains or residues .

Promoter-Reporter Fusions: Creating transcriptional fusions between the At2g36330 promoter and reporter genes like GUS or luciferase enables detailed analysis of expression patterns across tissues, developmental stages, and in response to environmental stimuli . This approach has been informative for other CASP-like genes in revealing their expression dynamics.

How can researchers effectively analyze the involvement of At2g36330 in plant-pathogen interactions?

Given the evidence that some CASP-like proteins are involved in pathogen responses, investigating At2g36330's role in plant-pathogen interactions requires specialized approaches:

Pathogen Challenge Assays: Exposing wild-type, At2g36330 mutant, and overexpression lines to various pathogens (bacterial, fungal, oomycete) allows quantification of resistance or susceptibility phenotypes. Key parameters to assess include pathogen growth/proliferation, disease symptoms, and spread of infection from the inoculation site .

Lignin Deposition Analysis: Since CASP-like proteins can mediate lignin-based barriers that restrict pathogen spread, histochemical staining for lignin (using phloroglucinol-HCl or toluidine blue) can reveal differences in lignin accumulation patterns between wild-type and genetically modified plants during pathogen challenge .

Pathogen Movement Tracking: Fluorescently labeled pathogens can be used to track their movement and spatial restriction in plant tissues, comparing wild-type plants with At2g36330 mutants or overexpressors. This approach can determine whether At2g36330 contributes to physical containment of pathogens .

Gene Expression Analysis: Quantitative RT-PCR or RNA sequencing following pathogen challenge can reveal whether At2g36330 is transcriptionally responsive to infection and can identify downstream genes affected by At2g36330 mutation or overexpression. This approach helps place At2g36330 within defense signaling networks .

How does At2g36330 compare with CASP-like proteins across different plant species?

Comparative analysis of CASP-like proteins across plant species provides evolutionary insights and functional predictions for At2g36330:

Phylogenetic Analysis: At2g36330 belongs to one of six CASPL subfamilies in Arabidopsis. Comparing its sequence with orthologs from other species can reveal evolutionary relationships and conservation patterns . For instance, ClCASPL from watermelon (Citrullus lanatus) was found to be orthologous to AtCASPL4C1 in Arabidopsis, suggesting conserved functions across species .

Domain Conservation: Analysis of protein domains and transmembrane regions between At2g36330 and related proteins from different species can identify highly conserved regions likely essential for function. Like other CASP-like proteins, At2g36330 contains four predicted transmembrane domains that are likely conserved across species .

Functional Divergence: Despite structural similarities, CASP-like proteins can have diverse functions across species. For example, while some are involved in Casparian strip formation, others regulate stress responses or growth. Comparing phenotypes of mutants across species can reveal whether At2g36330's function is conserved or has diverged during evolution .

Expression Pattern Comparison: Analyzing whether expression patterns of At2g36330 orthologs are conserved across species provides insights into functional conservation. For instance, if orthologs are consistently induced by pathogen challenge or cold stress across species, this suggests conserved regulatory mechanisms and functions .

What structural features distinguish At2g36330 from other CASP family members?

Understanding the unique structural features of At2g36330 compared to other CASP family members helps elucidate its specific functions:

Sequence Alignment Analysis: Detailed sequence comparisons between At2g36330 and other CASPs/CASPLs can identify unique residues or motifs that might confer functional specificity. Multiple sequence alignments focusing on the protein's functional domains are particularly informative .

Transmembrane Topology Prediction: While most CASP-like proteins contain four transmembrane domains, subtle differences in their arrangement or the length of connecting loops can influence protein function and interactions. Computational prediction tools can identify these differences between At2g36330 and other family members .

Protein-Protein Interaction Motifs: Analysis of potential interaction motifs in At2g36330 that differ from other CASP proteins may suggest unique binding partners. This could explain functional diversification within the family and can guide experimental approaches to identify interacting proteins.

Post-translational Modification Sites: Identifying unique sites for phosphorylation, glycosylation, or other modifications in At2g36330 compared to other CASPs may provide insights into differential regulation. Prediction tools and proteomic data can help identify these sites for experimental validation.

How can At2g36330 contribute to improving plant stress tolerance in agricultural applications?

Research on CASP-like proteins suggests potential applications for enhancing plant stress resilience through manipulation of At2g36330:

Pathogen Resistance Enhancement: Since some CASP-like proteins are involved in forming lignin-based barriers that restrict pathogen spread, modulating At2g36330 expression might enhance disease resistance . Overexpression in specific tissues or in response to pathogen detection signals could strengthen physical defense barriers.

Abiotic Stress Tolerance: Research on related CASP-like proteins has revealed roles in cold tolerance, suggesting At2g36330 might similarly influence abiotic stress responses . Genetic modification of At2g36330 expression or regulation could potentially enhance crop resilience to temperature fluctuations or other environmental stresses.

Growth Regulation: Studies of AtCASPL4C1 knockout plants revealed altered growth dynamics, including faster growth and increased biomass . Understanding how At2g36330 affects growth processes could inform strategies to optimize plant development and productivity under varying environmental conditions.

Nitrogen Assimilation Connection: While not directly related to At2g36330, research on nitrogen assimilation has identified master control genes affecting plant growth and development. Understanding potential interactions between At2g36330 and nitrogen metabolism pathways could reveal strategies to enhance nitrogen use efficiency .

What cutting-edge techniques are advancing our understanding of CASP-like protein function?

Several advanced methodologies are pushing the boundaries of CASP-like protein research:

Multi-omics Integration: Combining transcriptomics, proteomics, metabolomics, and phenomics data provides comprehensive insights into CASP-like protein functions. This approach can reveal how At2g36330 integrates into broader cellular networks and affects multiple aspects of plant physiology .

Single-cell Analysis: Emerging single-cell sequencing and imaging technologies enable examination of At2g36330 expression and function at unprecedented resolution, potentially revealing cell-type specific roles that would be masked in whole-tissue analyses.

Cryo-electron Microscopy: This technique can provide high-resolution structural information about membrane proteins like At2g36330, particularly their organization within membrane domains or complexes with other proteins. Such structural insights are critical for understanding function at the molecular level.

Live Cell Imaging Advances: New fluorescent probes and super-resolution microscopy techniques enable real-time visualization of membrane protein dynamics. These approaches can reveal how At2g36330 responds to stimuli, interacts with other proteins, and participates in membrane domain organization .

Synthetic Biology Approaches: Engineered variants of At2g36330 with modified domains or regulatory elements can help dissect protein function and potentially create novel properties for biotechnological applications. This approach moves beyond understanding natural function toward designing proteins with enhanced or novel capabilities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.