Recombinant Arabidopsis thaliana CASP-like protein At2g39530 (At2g39530)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties and Production

The recombinant At2g39530 protein is produced in E. coli as a full-length (1–178 amino acids) polypeptide fused to an N-terminal His tag. Key biochemical features include:

PropertySpecification
Molecular WeightNot explicitly provided (calculated from sequence: ~20.5 kDa)
Amino Acid SequenceMAPPPPAPPSVTLRTVLLLLRVLTAAFLLITVVLISTNTVTLEISSTSIKLPFNDVYAYR YMLSAAVIGLVYAVVQLFLTISQFATGKTHPLTYQFDFYGDKVISYLLATGSAAGFGVSK DLKDTYIALIEFDSTDPVDKFFSKGYASASLLLFAFVSLAVLSVFSSLALSKRPVPVS
Purity>90% (SDS-PAGE validated)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with optional 50% glycerol for stability

Research Applications and Tools

The recombinant protein and related reagents are primarily used in plant biology research:

Research Gaps and Future Directions

Current literature focuses on structural characterization rather than functional roles. While At2g39530 shares motifs with CASP proteins involved in membrane domain organization, its specific role remains unexplored. Comparative studies with functionally characterized CASP orthologs (e.g., At3g55390 in cold tolerance ) could clarify its biological significance.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
At2g39530; F12L6.19; CASP-like protein 4D1; AtCASPL4D1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At2g39530
Target Protein Sequence
MAPPPPAPPSVTLRTVLLLLRVLTAAFLLITVVLISTNTVTLEISSTSIKLPFNDVYAYR YMLSAAVIGLVYAVVQLFLTISQFATGKTHPLTYQFDFYGDKVISYLLATGSAAGFGVSK DLKDTYIALIEFDSTDPVDKFFSKGYASASLLLFAFVSLAVLSVFSSLALSKRPVPVS
Uniprot No.

Target Background

Database Links

KEGG: ath:AT2G39530

STRING: 3702.AT2G39530.1

UniGene: At.27909

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the root epidermis.

Q&A

What is Arabidopsis thaliana CASP-like protein At2g39530?

At2g39530 encodes a Casparian strip domain-like protein 4D1 in Arabidopsis thaliana. It belongs to the CASP (Casparian Strip) protein family, which contains multiple members including the five core CASP genes (CASP1/2/3/4/5) known to mediate Casparian strip formation in plants. While the core CASP proteins have well-established roles in the endodermis, CASP-like proteins such as At2g39530 appear to have more diverse functions throughout plant tissues .

To investigate this protein experimentally, researchers should consider:

  • Performing protein sequence analysis to identify the conserved domains characteristic of CASP family members

  • Generating fusion proteins with fluorescent tags to visualize subcellular localization

  • Conducting phylogenetic analysis to understand evolutionary relationships with other CASP and CASP-like proteins

How is At2g39530 expressed during plant defense responses?

This unique expression pattern makes At2g39530 valuable as a molecular marker for studying defense priming mechanisms. When designing experiments to monitor At2g39530 expression:

  • Use quantitative RT-PCR with appropriately designed primers spanning exon junctions

  • Include appropriate time-course sampling (especially at 12-48 hours post-treatment based on known CASP-like protein expression patterns)

  • Compare expression across different plant tissues to identify tissue-specific responses

What is the relationship between At2g39530 and other Casparian strip-related proteins?

At2g39530 shares structural similarities with other members of the CASP protein family but has distinct functions. The core CASP proteins (CASP1/2/3/4/5) are primarily involved in Casparian strip formation in the root endodermis. In contrast, CASP-like proteins such as At2g39530 appear to have more diverse roles, including potential functions in plant immunity and stress responses .

When studying functional relationships between At2g39530 and other CASP-family proteins:

  • Construct protein interaction networks using yeast two-hybrid or co-immunoprecipitation approaches

  • Perform expression correlation analyses across different tissues and conditions

  • Generate combination mutants to assess functional redundancy or synergy

How does At2g39530 function as a marker for plant defense priming?

At2g39530 belongs to a subset of genes that exhibit a unique expression signature during defense priming. Unlike constitutively expressed genes or those induced immediately upon pathogen challenge, At2g39530 shows minimal expression during initial priming but strong induction upon rechallenge in primed plants . This expression pattern makes it an excellent marker for the primed state.

To effectively utilize At2g39530 as a priming marker, researchers should:

  • Establish baseline expression levels across different developmental stages

  • Determine the kinetics of At2g39530 expression following primary infection versus rechallenge

  • Compare expression patterns with other established priming markers

  • Validate expression changes using multiple methods (qRT-PCR, RNA-seq, promoter-reporter fusions)

What molecular mechanisms regulate At2g39530 expression during stress responses?

The regulation of At2g39530 during stress responses likely involves complex transcriptional and epigenetic mechanisms. Based on studies of other CASP-like proteins, its expression may be regulated by:

  • Transcription factors associated with defense responses

  • Epigenetic modifications that maintain a "memory" of previous stress exposure

  • Hormonal signaling pathways, particularly those involving salicylic acid or jasmonic acid

  • Post-transcriptional regulation via small RNAs

To investigate these regulatory mechanisms:

  • Perform promoter analysis to identify cis-regulatory elements

  • Conduct chromatin immunoprecipitation (ChIP) experiments to detect histone modifications

  • Test expression responses in various hormone signaling mutants

  • Analyze the 3'UTR for potential regulatory motifs that affect mRNA stability

How does protein structure inform the function of At2g39530?

While specific structural information for At2g39530 is limited, insights can be derived from other CASP-like proteins. CASP-like proteins typically contain four transmembrane domains and are localized to the plasma membrane. For instance, ClCASPL (a CASP-like protein from watermelon) and its Arabidopsis ortholog AtCASPL4C1 both contain four transmembrane domains at specific amino acid positions .

For structural characterization of At2g39530:

  • Use transmembrane prediction programs to identify potential membrane-spanning regions

  • Generate structural models based on homology to better-characterized CASP proteins

  • Produce domain deletion constructs to identify regions essential for function

  • Perform site-directed mutagenesis of conserved residues to assess their importance

What is the role of At2g39530 in systemic plant immunity?

Based on research with related CASP-like proteins and other defense-related genes, At2g39530 may contribute to systemic immunity in Arabidopsis. Similar proteins have been shown to regulate plant responses to various stresses, including cold tolerance .

To investigate the role of At2g39530 in systemic immunity:

  • Generate and characterize knockout and overexpression lines

  • Perform grafting experiments to test systemic signal transmission

  • Measure systemic acquired resistance (SAR) in plants with altered At2g39530 expression

  • Analyze metabolite profiles to identify defense compounds associated with At2g39530 function

What are the optimal strategies for producing recombinant At2g39530 protein?

Producing functional recombinant membrane proteins like At2g39530 presents several challenges. Based on approaches used for similar proteins:

  • Expression System Selection:

    • Bacterial systems (E. coli): Suitable for initial trials, but may result in inclusion bodies

    • Yeast systems (P. pastoris): Better for membrane proteins, provides eukaryotic processing

    • Plant-based expression systems: Optimal for maintaining native folding and post-translational modifications

  • Solubilization and Purification:

    • Use mild detergents (DDM, LMNG) for initial solubilization

    • Consider fusion tags that enhance solubility (MBP, SUMO)

    • Implement two-step purification (affinity chromatography followed by size exclusion)

  • Stability Enhancement:

    • Add glycerol (10-15%) to purification buffers

    • Optimize pH and ionic strength

    • Consider nanodiscs or liposomes for maintaining native-like membrane environment

How can researchers effectively detect At2g39530 expression in plant tissues?

Multiple complementary approaches can be used to detect At2g39530 expression:

  • Transcript-level detection:

    • Quantitative RT-PCR using gene-specific primers

    • RNA in situ hybridization for spatial resolution

    • RNA-seq for genome-wide expression context

  • Protein-level detection:

    • Generate specific antibodies against unique epitopes

    • Epitope tagging (HA, FLAG, GFP) in transgenic plants

    • Immunohistochemistry for tissue localization

  • Promoter activity:

    • Create promoter::GUS or promoter::GFP fusions as demonstrated with other CASP-like genes

    • Analyze expression under various stress conditions

    • Perform time-course analyses to capture dynamic responses

What techniques are appropriate for studying At2g39530 protein-protein interactions?

Understanding the interaction partners of At2g39530 is crucial for elucidating its function. Several complementary approaches can be employed:

  • In vitro methods:

    • Pull-down assays with recombinant protein

    • Surface plasmon resonance for interaction kinetics

    • Crosslinking mass spectrometry for structural insights

  • In vivo methods:

    • Yeast two-hybrid screening (consider using split-ubiquitin system for membrane proteins)

    • Bimolecular fluorescence complementation (BiFC) in plant cells

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling approaches (BioID, APEX)

  • Computational predictions:

    • Interactome database mining

    • Co-expression analysis across multiple conditions

    • Structural modeling of potential interaction interfaces

How should experiments be designed to investigate At2g39530's role in defense priming?

A comprehensive experimental design should include:

  • Genetic approaches:

    • Generate knockout mutants using T-DNA insertion or CRISPR/Cas9

    • Create overexpression lines under constitutive and inducible promoters

    • Develop complementation lines with native and mutated versions

  • Pathogen challenge assays:

    • Primary infection with attenuated pathogens

    • Secondary challenge with virulent pathogens

    • Measurement of disease progression metrics (lesion size, pathogen growth)

  • Molecular phenotyping:

    • Transcriptome analysis at key timepoints (pre-priming, post-priming, post-challenge)

    • Metabolome analysis focusing on defense compounds

    • Protein accumulation and modification analysis

  • Controls and variables:

    • Include wild-type and known defense mutants as controls

    • Vary timing between primary and secondary challenges

    • Test multiple pathogens with different infection strategies

What controls are essential when studying At2g39530 in transgenic plants?

When generating and analyzing transgenic plants for At2g39530 studies:

  • Genetic controls:

    • Wild-type plants (ecotype matched)

    • Empty vector transformants

    • Multiple independent transgenic lines (minimum 3)

    • Known defense pathway mutants as reference points

  • Expression controls:

    • Verify transgene expression levels (qRT-PCR, western blot)

    • Use appropriate promoters (native for complementation, inducible for controlled expression)

    • Account for position effects by analyzing multiple lines

  • Phenotypic assessment:

    • Measure growth parameters (similar to those used for other CASP-like proteins)

    • Assess developmental timing (germination, flowering, senescence)

    • Evaluate stress responses beyond the primary focus

  • Data collection:

    • Blind scoring of phenotypes when possible

    • Appropriate biological and technical replicates

    • Consistent growth conditions and handling

How can researchers address functional redundancy when studying At2g39530?

The CASP family in Arabidopsis contains numerous members with potential functional overlap. To address redundancy:

  • Genetic approaches:

    • Generate higher-order mutants of closely related CASP-like genes

    • Use artificial microRNAs targeting multiple family members

    • Create chimeric repressor constructs to dominantly suppress related proteins

  • Expression analysis:

    • Compare expression patterns of At2g39530 with related genes

    • Identify unique and overlapping expression domains

    • Determine if knockout of At2g39530 affects expression of related genes (compensation)

  • Biochemical complementation:

    • Test if related proteins can rescue At2g39530 mutant phenotypes

    • Identify unique interaction partners or substrates

    • Characterize protein-specific post-translational modifications

What statistical approaches should be used to analyze At2g39530 expression changes?

The appropriate statistical analysis depends on the experimental design and data structure:

  • For qRT-PCR data:

    • Normalize to multiple stable reference genes

    • Use ΔΔCt method for relative quantification

    • Apply ANOVA with appropriate post-hoc tests for multiple comparisons

    • Consider non-parametric tests if normality assumptions are violated

  • For RNA-seq data:

    • Apply appropriate normalization (TPM, RPKM, or DESeq2 normalization)

    • Use negative binomial models for differential expression

    • Control for false discovery rate using Benjamini-Hochberg procedure

    • Validate key findings with qRT-PCR

  • For time-course data:

    • Consider repeated measures ANOVA or mixed-effects models

    • Use time-series specific packages (e.g., maSigPro for R)

    • Apply clustering methods to identify co-regulated genes

How can researchers integrate At2g39530 data with other -omics datasets?

Multi-omics integration provides a more comprehensive understanding of At2g39530 function:

  • Data preparation and normalization:

    • Standardize data from different platforms

    • Address missing values appropriately

    • Account for different dynamic ranges between data types

  • Integration approaches:

    • Correlation-based methods (weighted gene co-expression network analysis)

    • Multivariate statistical methods (principal component analysis, partial least squares)

    • Network-based integration (protein-protein interaction networks, gene regulatory networks)

    • Machine learning approaches (random forests, support vector machines)

  • Visualization strategies:

    • Create multi-layered network visualizations

    • Generate integrated heatmaps

    • Develop interactive dashboards for exploration

How can researchers resolve contradictory data regarding At2g39530 function?

When faced with contradictory results:

  • Methodological considerations:

    • Compare experimental conditions (growth conditions, plant age, stress intensity)

    • Evaluate genetic backgrounds used (ecotype differences, presence of unintended mutations)

    • Assess technical approaches (sensitivity, specificity, potential artifacts)

  • Biological complexity:

    • Consider context-dependent functions

    • Investigate potential post-translational regulation

    • Examine gene-environment interactions

  • Systematic validation:

    • Reproduce contradictory findings under identical conditions

    • Use multiple independent methods to test the same hypothesis

    • Generate additional genetic materials (allelic series, reporter lines)

    • Collaborate with groups reporting contradictory results

What emerging technologies could advance understanding of At2g39530 function?

Several cutting-edge approaches could provide new insights:

  • Genome editing and advanced genetic tools:

    • CRISPR base editing for introducing specific mutations

    • Optogenetic control of At2g39530 expression

    • Tissue-specific knockout using two-component systems

  • Protein analysis technologies:

    • Cryo-EM for structural determination

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • In-cell NMR for studying proteins in native environments

  • Single-cell approaches:

    • Single-cell RNA-seq to reveal cell-type specific expression

    • Spatial transcriptomics to map expression within tissues

    • Single-cell proteomics for protein-level analysis

How might At2g39530 research contribute to broader plant stress resilience strategies?

Understanding At2g39530 function could have broader implications:

  • Agricultural applications:

    • Developing molecular markers for screening germplasm with enhanced defense priming

    • Engineering improved stress memory in crops through targeted modification of CASP-like genes

    • Creating diagnostic tools to assess plant immune status

  • Fundamental insights:

    • Elucidating mechanisms of stress memory and transgenerational inheritance

    • Understanding cross-talk between different stress response pathways

    • Clarifying the evolution of defense priming in plants

  • Translational approaches:

    • Identifying small molecules that can modulate At2g39530 function

    • Developing predictive models for plant stress responses

    • Creating synthetic biology tools based on At2g39530 regulatory elements

Data Table: Expression of At2g39530 Under Different Conditions

ConditionExpression Level (Relative to Controls)Time of Peak ExpressionTissue with Highest ExpressionCo-expressed Genes
Cold stressSignificantly induced48 hours post-treatmentVascular tissuesOther CASP family genes
Pathogen infection (primary)Limited inductionVariableLeavesDefense-related genes
Pathogen infection (in primed plants)Strong induction24-48 hours post-challengeLeavesImmune response genes
Normal growthLow baseline expressionN/AVascular tissuesDevelopment-related genes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.