Recombinant Arabidopsis thaliana CASP-like protein At3g14380 (At3g14380)

What is the basic structure of At3g14380 protein?

Recombinant At3g14380 (Q9LUL1) is a 178 amino acid CASP-like protein from Arabidopsis thaliana. The full amino acid sequence is: MDKTDQTAIDESALVLNRTEKSAEAVLRVASMALSITGLVIMIKNSISNEFGSVSYSNIGAFMYLVSANGVCAAYSLLSALAILALPCPISKVQVRTLFLLDQVVTYVVLAAGAVSAETVYLAYYGNIPITWSSACDSYGSFCHNALISVVFTFVVSLLYMLLSLISSYRLFTRFEAP . This protein is classified as a CASP-like protein 2A2 (AtCASPL2A2) and contains transmembrane domains characteristic of CASP family proteins that are often involved in membrane organization and signaling.

What is the expression pattern of At3g14380 in Arabidopsis tissues?

RT-PCR analysis has shown that At3g14380 exhibits highest expression in flowers and buds, with lower expression levels detected in roots and yellow siliques . Interestingly, two splice variants of this gene have been confirmed as expressed in flowers and buds . Additional studies using promoter-GFP fusions revealed high levels of expression in epidermal abscission zone (AZ) cells from flower positions 1 to 18, as well as in stigmas, anther filaments, and pollen of flowers from positions 1 to 3 . This tissue-specific expression pattern strongly suggests a specialized role in floral development and abscission processes.

How can researchers effectively study At3g14380 expression in plant tissues?

For studying At3g14380 expression, researchers can employ reverse-transcriptase PCR (RT-PCR) to detect and quantify target mRNA transcripts across different tissues . This method has been successfully used to validate tissue-specific expression patterns of At3g14380. When designing RT-PCR experiments for At3g14380, researchers should consider using an annealing temperature of 55°C for optimal results, as documented in previous studies . Additionally, promoter-reporter fusions (such as promoter-GFP constructs) can be used to visualize spatial expression patterns in planta, which has proven effective in localizing At3g14380 expression to specific cell types within floral organs .

What are the recommended conditions for working with recombinant At3g14380 protein?

When working with recombinant At3g14380 protein, it is recommended to briefly centrifuge the vial before opening to bring contents to the bottom. The lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, add glycerol to a final concentration of 5-50% (50% is the default recommendation) and aliquot for storage at -20°C/-80°C . Repeated freezing and thawing should be avoided, and working aliquots can be stored at 4°C for up to one week . The protein has greater than 90% purity as determined by SDS-PAGE and is supplied in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

What is the role of At3g14380 in the abscission process?

At3g14380 has been identified as a functional component in the floral organ abscission process in Arabidopsis thaliana . Analysis of T-DNA insertion lines that function as knockouts of At3g14380 has revealed that silencing of this gene delays the timing of petal abscission . This finding suggests that At3g14380 is required for the normal progression of organ shedding. The protein likely contributes to cell wall remodeling or cell-cell communication processes that are essential for coordinated separation of floral organs. The delayed abscission phenotype observed in knockout lines indicates that while At3g14380 is not absolutely required for abscission to occur, it plays an important role in regulating the timing and efficiency of this developmental process.

How does At3g14380 compare to other genes involved in abscission?

At3g14380 functions alongside other abscission-related genes including At1g64405, At2g23630, At2g44010, At3g53040, At3g56350, and At5g50540, which have been identified through targeted studies of the abscission zone . These genes show distinctive expression patterns: At3g14380 is highly expressed in flowers and buds, while At3g53040 and At3g56350 share a pattern with highest expression in yellow siliques and lower levels in roots, buds, and flowers . At5g50540 shows greatest expression in roots and yellow siliques with trace expression in buds and flowers . The distinct expression patterns suggest specialized but potentially complementary roles in the complex process of organ abscission, with At3g14380 potentially focusing on early stages of the process due to its high expression in flowers and buds.

What approaches can be used to investigate the molecular function of At3g14380?

To investigate the molecular function of At3g14380, researchers can employ several complementary approaches:

• Gene Knockout Analysis: T-DNA insertion lines can be used to create functional knockouts, as previously done to demonstrate At3g14380's role in floral organ shedding . Phenotypic analysis of these lines can reveal timing changes in abscission and other developmental processes.

• Tissue-Specific Expression Analysis: RT-PCR and promoter-reporter fusions provide spatial and temporal information about gene expression . For At3g14380, RT-PCR conditions should be optimized with denaturation at 95°C for 5 min, followed by 26 cycles of denaturation at 95°C for 30 s and annealing at 55°C for 30 s .

• Transcriptomic Profiling: High-throughput sequencing approaches similar to those used for Brassica oleracea can identify co-expressed genes and potentially related pathways . This approach could utilize RNA from specific tissues expressing At3g14380 for deeper insights into its regulatory network.

• Cell-Specific Isolation: Using promoter-GFP markers specific to abscission zones (such as ProAt2g41850::GFP) can help isolate specific cell populations undergoing abscission for transcriptomic analysis . This technique minimizes tissue manipulation and preserves native expression patterns.

How can researchers isolate and study specific abscission zone cells expressing At3g14380?

A novel approach for studying abscission zone cells involves using reporter genes like ProAt2g41850::GFP, which marks cells that have undergone natural separation . This method takes advantage of cell wall degradation that occurs during abscission and minimizes manipulation of the tissue, thereby maintaining native transcript levels. The steps involve:

• Generate transgenic plants expressing a fluorescent marker under the control of an abscission-specific promoter

• Visualize and collect marked cells that have undergone separation

• Extract mRNA from collected cells for transcriptomic analysis or RT-PCR

• Compare expression of At3g14380 with other abscission-related genes

This technique has successfully identified At3g14380 as part of a suite of genes specifically expressed during the abscission process . For researchers interested in At3g14380 function, this approach provides a way to study the gene in its native regulatory context.

What tools are available for validating At3g14380 transcriptome assembly and expression?

For validating At3g14380 transcriptome assembly and expression profiles, researchers have several effective tools at their disposal:

• RT-PCR Validation: RT-PCR has proven effective for validating the existence of predicted genes from de novo assembly and confirming tissue-specific expression patterns . For At3g14380, specific primer sets can be designed based on the gene sequence, with PCR products visualized on 1.5% agarose gel containing ethidium bromide .

• Splice Variant Identification: RT-PCR can be specifically designed to detect splice variants, which have been confirmed for At3g14380 in flower and bud tissues . Understanding these variants may provide insights into potential differential functions.

• De Novo Assembly Optimization: When assembling transcriptome data that includes At3g14380, researchers should consider optimal k-mer lengths (57-59 has been effective) and coverage cutoffs to enhance assembly results . This approach can be validated using RT-PCR to confirm the presence of assembled transcripts.

How can differential expression of At3g14380 be accurately measured across developmental stages?

To accurately measure differential expression of At3g14380 across developmental stages, researchers should consider:

• Precise Tissue Sampling: Collection of tissues at well-defined developmental stages, particularly focusing on floral positions 1-18 where expression has been documented in abscission zones .

• Normalization Controls: Using appropriate reference genes such as Arabidopsis actin (AF044573) with primers 5'-TGGTTGGGATGAACCAGAAG-3' and 5'-CCAGAGTCCAGCACAATACC-3' for normalization of expression data .

• Quantitative RT-PCR: For precise quantification of expression levels, qRT-PCR should be employed with appropriate controls and technical replicates. Based on previous research, an annealing temperature of 55°C has been effective for At3g14380 .

• RNA-Seq Analysis: For genome-wide context, RNA-Seq data can be analyzed using appropriate bioinformatic pipelines, with At3g14380 expression compared across tissues and developmental stages. This approach has been successfully used with similar genes in high-throughput sequencing projects .

What are the biochemical properties of recombinant At3g14380 protein that might affect experimental design?

The recombinant At3g14380 protein has several biochemical properties that should be considered when designing experiments:

• Protein Size and Structure: The full-length protein consists of 178 amino acids with a His-tag at the N-terminus . The sequence suggests membrane-associated domains typical of CASP-like proteins.

• Solubility and Storage: The protein is supplied as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For stability, adding glycerol to a final concentration of 5-50% is recommended.

• Stability Considerations: The protein should not undergo repeated freeze-thaw cycles, and working aliquots should be stored at 4°C for no more than one week . Long-term storage requires -20°C/-80°C conditions.

• Buffer Compatibility: The protein is supplied in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . Researchers should consider buffer compatibility when designing functional assays or when combining with other reagents.

What experimental controls should be implemented when studying At3g14380 function?

When studying At3g14380 function, several experimental controls should be implemented:

• Genetic Controls: In knockout or overexpression studies, wild-type plants and ideally complementation lines should be used as controls. Previous studies have compared At3g14380 T-DNA insertion lines with wild-type plants and other abscission mutants like blade-on-petiole1 (bop1)/bop2 and IDA-overexpressing lines .

• Expression Controls: When analyzing gene expression, multiple reference genes should be used for normalization. Arabidopsis actin (AF044573) has been successfully used as a control gene in studies involving At3g14380 .

• Tissue Controls: When analyzing tissue-specific expression, include both target tissues (flowers, buds) and control tissues (leaves, stems) where At3g14380 expression is expected to be minimal .

• Developmental Controls: Include multiple developmental stages in analyses, as At3g14380 expression varies with floral development and abscission progression .

What are promising research avenues for understanding At3g14380's role in plant development?

Based on current knowledge, several promising research directions for At3g14380 include:

• Interactome Analysis: Identifying protein-protein interactions involving At3g14380 would provide insights into its functional network. Techniques such as yeast two-hybrid, co-immunoprecipitation, or pull-down assays could reveal its binding partners in abscission pathways .

• Cell Wall Remodeling: Given its expression in abscission zones, investigating At3g14380's potential role in cell wall modifications during organ separation would be valuable. This could involve microscopic analysis of cell wall structures in knockout vs. wild-type plants during abscission.

• Hormonal Regulation: Exploring how plant hormones like ethylene and auxin regulate At3g14380 expression could clarify its position in abscission signaling pathways.

• Comparative Analysis: Studying homologs of At3g14380 in other plant species could reveal evolutionary conservation of function and potentially identify specialized roles in different abscission processes.

How might researchers address contradictory data regarding At3g14380 function?

When faced with contradictory data regarding At3g14380 function, researchers should consider:

• Genetic Background Effects: Different Arabidopsis ecotypes may show variable phenotypes; therefore, all comparisons should be made in the same genetic background, with appropriate controls.

• Environmental Conditions: Abscission processes are influenced by environmental factors; thus, growth conditions should be strictly controlled and thoroughly documented.

• Developmental Timing: The precise developmental stage of analysis is critical, as At3g14380 appears to affect the timing of abscission rather than the absolute ability to abscise .

• Technical Approaches: Different experimental techniques (genetic, biochemical, microscopic) may yield apparently contradictory results that could be reconciled through integrated approaches.

• Functional Redundancy: Consider potential redundancy with other CASP-like proteins or abscission-related genes, which might mask phenotypes in single gene knockout studies.