Recombinant Arabidopsis thaliana CASP-like protein At3g16300 (At3g16300)

Shipped with Ice Packs
In Stock

Description

Membrane Domain Formation

CASP proteins are known to create protein-exclusion zones in plant membranes, critical for spatially organizing enzymatic activities (e.g., lignification during Casparian strip development) . At3g16300’s transmembrane domains suggest a similar role in membrane subdomain organization.

Cold Stress Response

Orthologs like AtCASPL4C1 (At3g55390) in Arabidopsis modulate cold tolerance and growth dynamics. Knockout mutants exhibit enhanced biomass and cold resistance, though Casparian strip formation remains unaffected . At3g16300 may share analogous roles in stress adaptation.

Interactions and Pathways

Bioinformatics tools predict involvement in pathways such as:

  • Cell wall synthesis: Potential interactions with lignification enzymes (e.g., peroxidases, NADPH oxidases) .

  • Vascular tissue development: Indirect evidence from CASP family studies on membrane domain regulation .

Research Applications

The recombinant protein is employed in:

  • Structural studies: Crystallization trials (e.g., space group P222 for related TS proteins) .

  • Immunoassays: ELISA kits for detecting At3g16300 in plant extracts or recombinant systems .

  • Functional assays: Investigating interactions with membrane-localized proteins (e.g., EXO70A1 secretion landmarks) .

Key Research Gaps

  1. Direct functional characterization: No studies confirm At3g16300’s role in Casparian strips or stress responses.

  2. Interaction partners: Limited data on binding partners or regulatory molecules.

  3. Post-translational modifications: No evidence of glycosylation or phosphorylation in recombinant forms.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate this in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us and we will prioritize its development.
Synonyms
At3g16300; MYA6.9; T2O4.16; CASP-like protein 3A1; AtCASPL3A1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-212
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At3g16300
Target Protein Sequence
MAKAAEQKQNPTVASAEAKLDIRDVVNTAITYGEDNRHGGGKRNDVAMFVLRAMCMAVST VAVTLMVTARETSMTTLYGFEFQLHAVWSLSDSLIYLVVVSSATVLYSLIQLIISGTRLM RKSPVIPTRTQAWFCFVADQIIGYAMVSGGSAALGVTNMNRTGIRHMPLPNFCKSLGFFC DHLAGSIVFALFAFLLLAASSLLDVLHLSRHR
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of At3g16300?

At3g16300 is a CASP-like protein containing multiple transmembrane domains that suggest a role in membrane subdomain organization. The protein belongs to the CASP-LIKES family, which includes 39 members in Arabidopsis, part of the broader eukaryotic MARVEL protein superfamily . Structurally, At3g16300 shares characteristics with other CASP proteins that create protein-exclusion zones in plant membranes. Crystallization trials of related proteins have been conducted in space group P222, providing insights into the potential structural features of At3g16300. To characterize this protein, researchers typically employ a combination of predictive bioinformatics and experimental approaches including hydropathy analysis, transmembrane prediction algorithms, and recombinant protein expression systems for structural studies.

How does At3g16300 function in comparison to other characterized CASP family proteins?

At3g16300 likely functions similarly to other CASP proteins in creating membrane domains of protein exclusion and cell wall attachment. CASPs suppress further secretion to initial foci by evicting EXO70A1 secretion landmarks, which forces displacement of secretory foci along the median line . Unlike the well-characterized CASP1-5 proteins that are strongly expressed in the endodermis and localize to the Casparian Strip Domain (CSD), At3g16300's specific localization and expression pattern requires further investigation . Orthologous proteins like AtCASPL4C1 (At3g55390) modulate cold tolerance and growth dynamics, with knockout mutants exhibiting enhanced biomass and cold resistance, suggesting At3g16300 may have analogous roles in stress adaptation. Functional assays comparing At3g16300 with other CASP proteins should include subcellular localization studies, protein-protein interaction analyses, and phenotypic characterization of knockout/knockdown lines.

What databases and bioinformatic tools are most useful for studying At3g16300?

The following databases and tools are essential for At3g16300 research:

Database/ToolIdentifier/ApplicationUse Case
KEGGath:AT3G16300Pathway analysis and functional annotation
STRING3702.AT3G16300.1Protein-protein interaction predictions
TAIRAT3G16300Gene structure, expression, and mutant information
PhytozomeComparative genomics across plant species
ePlantVisualizing gene expression, protein structure, and interactions
PLAZAOrthology relationships and synteny analysis

For sequence analysis, tools such as TMHMM for transmembrane domain prediction, SignalP for signal peptide detection, and SWISS-MODEL for homology modeling provide valuable structural insights. Phylogenetic analysis using MEGA or RAxML helps understand evolutionary relationships within the CASP-LIKE family. Integration of these resources enables comprehensive characterization of At3g16300's potential functions and interactions.

How can CRISPR-Cas9 technology be optimized for generating At3g16300 knockout lines?

Creating efficient At3g16300 knockout lines requires careful gRNA design and validation strategies. Based on approaches used for other CASP genes, researchers should:

  • Design at least two gRNAs targeting exon regions of At3g16300, preferably within conserved domains

  • Validate gRNA efficiency using in vitro cleavage assays before transformation

  • Transform Arabidopsis using established floral dip protocols with Agrobacterium

  • Screen transformants using PCR-based genotyping and sequencing to confirm mutations

  • Validate knockout at the protein level using immunoblotting with specific antibodies

For multiplexed editing approaches (targeting multiple CASP genes simultaneously), researchers can adapt the methodology used for generating the casp quintuple (caspQ) mutant, which combined T-DNA insertions with CRISPR-Cas9 targeting . This approach would be particularly valuable for functional redundancy studies, as the 39 members of the CASP-LIKES family may have overlapping functions. Phenotypic validation should include barrier function assays using propidium iodide penetration into the central vasculature, similar to established protocols for other CASP mutants .

What methodologies effectively distinguish between At3g16300's membrane domain organization function and potential roles in stress responses?

A comprehensive experimental approach would include:

  • Membrane domain studies:

    • Fluorescent protein fusion constructs (At3g16300-GFP/RFP) for live-cell imaging

    • Co-localization experiments with known membrane domain markers

    • FRAP (Fluorescence Recovery After Photobleaching) to analyze protein mobility in membranes

    • Super-resolution microscopy to characterize protein-exclusion zones

  • Stress response characterization:

    • Comparative transcriptomics of wild-type and At3g16300 mutants under various stresses

    • Analysis of knockout phenotypes under cold, osmotic, and oxidative stress conditions

    • Measurement of physiological parameters (ion leakage, ROS production, proline content)

    • Complementation assays with orthologous genes like AtCASPL4C1

  • Integration analysis:

    • Yeast two-hybrid or BiFC assays to identify protein interaction partners

    • ChIP-seq to identify transcription factors regulating At3g16300 expression

    • Proteomics analysis of membrane fractions under control and stress conditions

This multi-faceted approach enables researchers to distinguish direct membrane organizational effects from secondary stress response phenotypes, providing mechanistic insights into At3g16300 function.

What parameters affect the solubility and stability of recombinant At3g16300 during expression and purification?

Optimizing recombinant At3g16300 production requires careful consideration of several parameters:

ParameterRecommendationsRationale
Expression systemPrefer E. coli strains designed for membrane proteins (C41, C43)Transmembrane domains require specialized hosts
Expression tagsTest both N and C-terminal tags (His, GST, MBP)Membrane proteins often show tag position-dependent folding
Induction conditionsLower temperatures (16-20°C) and reduced IPTG concentrationsSlows expression rate, improving folding
Detergent selectionScreen mild detergents (DDM, LMNG, digitonin)Critical for membrane protein solubilization
Buffer compositionInclude glycerol (10-20%) and stability enhancersPrevents aggregation during purification
Purification strategyTwo-step approach: affinity chromatography followed by size exclusionRemoves aggregates and improves purity

For structural studies, researchers should evaluate protein stability using thermal shift assays and dynamic light scattering before attempting crystallization. Successful purification enables subsequent functional assays investigating interactions with lignification enzymes and other membrane-localized proteins like EXO70A1 .

How can researchers evaluate At3g16300's role in cell wall synthesis and lignification pathways?

A comprehensive approach to investigating At3g16300's role in cell wall synthesis and lignification should include:

  • Histochemical analysis:

    • Basic Fuchsin staining to visualize lignin deposition patterns

    • Phloroglucinol-HCl staining to detect changes in lignin composition

    • Calcofluor White staining for cellulose visualization

    • Toluidine Blue O for general cell wall structure

  • Biochemical characterization:

    • Quantitative lignin analysis using acetyl bromide soluble lignin (ABSL) assay

    • Cell wall composition analysis using FTIR spectroscopy

    • Monolignol composition analysis using GC-MS or HPLC

    • Activity assays for lignification enzymes (peroxidases, laccases)

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with known lignification enzymes

    • Interaction studies with NADPH oxidases implicated in lignin polymerization

    • BiFC assays to visualize interactions in planta

    • Proximity labeling approaches (BioID) to identify local interactome

  • Comparative transcriptomics:

    • RNA-seq analysis of At3g16300 mutants focusing on cell wall biosynthesis genes

    • qRT-PCR validation of key lignification pathway components

By combining these approaches, researchers can differentiate between direct involvement in lignification (protein-protein interactions with enzymes) versus indirect effects through membrane domain organization that spatially constrains lignification activities . Compare results to mutants with interrupted Casparian strips (casp1-1 casp3-1 and esb1-1) or absent Casparian strips (myb36) to contextualize phenotypes .

What approaches can resolve contradictory data when analyzing At3g16300 knockout phenotypes?

Resolving contradictory phenotypic data requires systematic troubleshooting and validation:

  • Verify knockout efficiency:

    • Confirm complete gene knockout using RT-PCR, qRT-PCR, and immunoblotting

    • Sequence the mutation site to ensure frameshift or large deletion

    • Check for potential alternative splice variants or truncated proteins

  • Control for genetic background effects:

    • Generate multiple independent knockout lines

    • Perform complementation studies by reintroducing At3g16300

    • Create knockouts in different ecotypes to assess background dependency

  • Evaluate developmental staging:

    • Perform time-course experiments to capture transient phenotypes

    • Carefully document developmental stages when phenotyping

    • Use standardized growth conditions to minimize environmental variation

  • Account for functional redundancy:

    • Generate higher-order mutants with related CASP-LIKE genes

    • Perform expression analysis of other family members in the At3g16300 mutant

    • Use inducible RNAi or amiRNA approaches targeting multiple family members

  • Apply statistical rigor:

    • Use appropriate statistical tests for phenotypic data

    • Include sufficient biological and technical replicates

    • Consider Bayesian approaches for complex phenotypic data

This methodical approach helps disambiguate true phenotypes from artifacts, especially important when studying proteins from large gene families with potential functional redundancy . Document all experimental conditions precisely to enable accurate replication by other researchers.

What specialized imaging techniques best capture At3g16300's membrane localization and dynamics?

Advanced imaging approaches for studying At3g16300 include:

Imaging TechniqueApplicationResolution/Advantages
TIRF microscopyVisualize protein at plasma membrane100-200 nm lateral resolution; excellent for membrane dynamics
FRET/FLIMProtein-protein interactions in membranesCan detect interactions at 1-10 nm distances
Single-molecule trackingProtein diffusion and clusteringTracks individual molecules; reveals subpopulations
Super-resolution (STED, PALM, STORM)Nanoscale organization of membrane domains20-50 nm resolution; visualizes protein exclusion zones
Correlative light-electron microscopyUltrastructural context of protein localizationCombines fluorescence data with ultrastructural details
Lattice light-sheet microscopyDynamic processes in living cellsReduced phototoxicity; suited for long-term imaging

For membrane dynamics studies, researchers should employ photoconvertible fluorescent tags (e.g., mEOS, Dendra2) to track protein movement between different membrane regions. Analysis of At3g16300-fluorescent protein fusions should include controls for functionality by complementation of knockout phenotypes. Quantitative image analysis should employ specialized software packages like Fiji/ImageJ with membrane analysis plugins, or commercial platforms like Imaris or Volocity for 3D reconstruction .

How can researchers differentiate between direct and indirect effects of At3g16300 on Casparian strip formation?

To distinguish direct from indirect effects on Casparian strip formation:

  • Temporal analysis of events:

    • Time-lapse imaging of fluorescently tagged At3g16300 and Casparian strip markers

    • Inducible expression/degradation systems to trigger At3g16300 presence/absence

    • Correlation analysis of protein localization with lignification onset

  • Spatial organization studies:

    • High-resolution imaging of At3g16300 localization relative to EXO70A1 secretion landmarks

    • Analysis of protein exclusion zone formation in wildtype versus mutant backgrounds

    • Electron microscopy to visualize membrane attachment to lignified wall

  • Functional domain analysis:

    • Structure-function studies with truncated or chimeric proteins

    • Site-directed mutagenesis of key residues predicted to mediate interactions

    • Domain swapping with other CASP-LIKE proteins

  • Interaction network mapping:

    • Identify direct interaction partners using proximity labeling

    • Characterize the kinetics of protein complex formation during strip development

    • Compare At3g16300 interaction networks with those of well-characterized CASPs

By integrating these approaches, researchers can determine whether At3g16300 directly participates in membrane domain organization and lignification regulation (like other CASP proteins) or influences these processes indirectly through other pathways . Evidence suggests CASP proteins are not needed for localization or activity of lignification enzymes but rather form membrane domains of protein exclusion and cell wall attachment that regulate secretion patterns and lignification boundaries .

What experimental approaches can characterize post-translational modifications of At3g16300?

A comprehensive PTM characterization workflow includes:

  • Identification of PTM sites:

    • Mass spectrometry analysis of purified recombinant or native At3g16300

    • Phosphoproteomics to identify phosphorylation sites

    • Glycoproteomics to detect and characterize glycosylation

    • Ubiquitinomics to identify ubiquitination sites

  • Functional validation:

    • Site-directed mutagenesis of identified PTM sites (e.g., phospho-null, phospho-mimetic)

    • Complementation assays with PTM-site mutants in knockout backgrounds

    • Analysis of PTM-site mutant protein localization and dynamics

  • Temporal and stimulus-dependent regulation:

    • Time-course analysis of PTMs following biotic/abiotic stresses

    • Identification of kinases, glycosyltransferases, or other modifying enzymes

    • Pharmacological inhibition of PTM-mediating enzymes to assess functional consequences

  • Structural impact assessment:

    • In silico modeling of PTM effects on protein structure and interaction interfaces

    • Biophysical characterization of modified versus unmodified protein

    • Analysis of PTM effects on protein stability and turnover rates

Current evidence suggests limited information on post-translational modifications of recombinant At3g16300 forms, with no confirmed glycosylation or phosphorylation reported. This represents a significant knowledge gap that researchers should address, particularly given the regulatory importance of PTMs in membrane protein function and localization.

How can protein-protein interaction studies reveal At3g16300's functional partners in membrane organization?

A multi-tiered approach to identifying At3g16300 interaction partners includes:

  • In vitro interaction screening:

    • Yeast two-hybrid screening with membrane-based systems (split-ubiquitin Y2H)

    • Protein arrays with recombinant At3g16300 as bait

    • Pull-down assays with tagged recombinant protein

  • In vivo interaction validation:

    • Co-immunoprecipitation from plant membrane fractions

    • Split-fluorescent protein complementation (BiFC) in planta

    • FRET/FLIM analysis of potential interaction pairs

  • Proximity-based interactomics:

    • BioID or TurboID fusion proteins for proximity labeling

    • APEX2-based proximity labeling in membrane compartments

    • Crosslinking mass spectrometry (XL-MS) for transient interactions

  • Functional validation of interactions:

    • Co-localization studies of At3g16300 with identified partners

    • Mutant analysis of interaction partners for similar phenotypes

    • Competition assays to identify interaction domains

Current research suggests potential interactions with lignification enzymes (peroxidases, NADPH oxidases) and secretory pathway components like EXO70A1 . Investigating these interactions would provide mechanistic insights into how At3g16300 contributes to membrane domain organization and subsequent processes like lignification during Casparian strip development.

How should researchers integrate multi-omics data to build comprehensive models of At3g16300 function?

Integrating multiple omics datasets requires a structured approach:

  • Data collection and preprocessing:

    • Generate or compile transcriptomics, proteomics, metabolomics, and phenomics datasets

    • Ensure consistent experimental conditions and genetic backgrounds

    • Apply appropriate normalization and quality control procedures

  • Multi-omics integration strategies:

    • Correlation network analysis across different data types

    • Pathway enrichment analysis combining multiple data layers

    • Machine learning approaches to identify patterns across datasets

    • Bayesian network modeling to infer causal relationships

  • Visualization and interpretation:

    • Create multi-dimensional visualizations (e.g., Cytoscape networks)

    • Map data onto known biological pathways using KEGG or MapMan

    • Develop interactive data exploration tools for complex patterns

  • Hypothesis generation and validation:

    • Identify key nodes and edges in integrated networks for experimental testing

    • Use computational models to predict outcomes of genetic perturbations

    • Design targeted experiments to validate computational predictions

By integrating these diverse data types, researchers can construct comprehensive models of At3g16300 function that span from molecular interactions to cellular and organismal phenotypes. This systems biology approach is particularly valuable for placing At3g16300 in the broader context of membrane domain organization, cell wall development, and stress responses .

What emerging technologies show promise for advancing At3g16300 research?

Several cutting-edge technologies offer new opportunities for At3g16300 research:

TechnologyApplicationAdvantage for At3g16300 Research
Cryo-electron microscopyHigh-resolution structural determinationCan resolve membrane protein structures in native-like environments
OptogeneticsSpatiotemporal control of protein functionEnables precise manipulation of At3g16300 activity in specific cells
CRISPR base/prime editingPrecise gene editingCreates specific mutations without double-strand breaks
Single-cell omicsCell-type specific analysisResolves heterogeneity in At3g16300 expression and function
Organoid systems3D tissue culture modelsStudies At3g16300 in tissue-like contexts in vitro
Nanobodies/synthetic binding proteinsTargeting specific protein conformationsEnables visualization and manipulation of active At3g16300
Advanced proteomics (HX-MS, HDX-MS)Protein dynamics and conformational changesExamines structural changes upon binding or membrane insertion
AI-powered structure predictionComputational structural biologyPredicts At3g16300 structure and interaction interfaces

Researchers should consider integrating these emerging technologies into their experimental design to address previously intractable questions about At3g16300 function, particularly regarding its membrane dynamics, protein-protein interactions, and tissue-specific roles .

What are the most significant open questions in At3g16300 research?

The most pressing unresolved questions about At3g16300 include:

  • What is the precise subcellular localization pattern of At3g16300 across different tissues and developmental stages?

  • How does At3g16300 contribute to membrane domain organization compared to the well-characterized CASP1-5 proteins?

  • What are the direct interaction partners of At3g16300 in different cellular contexts?

  • How is At3g16300 expression and localization regulated in response to environmental stresses?

  • What post-translational modifications regulate At3g16300 function?

  • Does At3g16300 have roles beyond membrane domain organization, potentially in signaling or metabolism?

  • How do At3g16300 and other CASP-LIKE proteins coordinate their activities?

  • What evolutionary forces have shaped the diversification of the CASP-LIKE family in plants?

Addressing these questions requires integrating advanced imaging, molecular genetics, biochemistry, and computational approaches. Progress will enhance our understanding of plant membrane biology, cell wall development, and stress responses .

How can contradictory findings in At3g16300 research be reconciled through methodological improvements?

Researchers can address contradictory findings through methodological improvements:

  • Standardization of experimental systems:

    • Establish consensus growth conditions and developmental staging

    • Create standardized genetic backgrounds for mutant analysis

    • Develop shared protein expression and purification protocols

  • Improved knockout validation:

    • Implement multi-level validation (DNA, RNA, protein) of mutants

    • Characterize potential compensatory mechanisms in knockouts

    • Document knockout effects across multiple environmental conditions

  • Enhanced reproducibility practices:

    • Preregister experimental designs and analysis plans

    • Share detailed protocols through platforms like protocols.io

    • Make raw data accessible through appropriate repositories

  • Collaborative validation approaches:

    • Organize multi-laboratory replication studies for key findings

    • Create community resources (antibodies, mutant lines, vectors)

    • Establish consensus phenotyping methodologies

  • Integration of computational and experimental approaches:

    • Develop predictive models that can reconcile seemingly contradictory data

    • Apply meta-analysis techniques to synthesize findings across studies

    • Use systems biology approaches to place contradictory findings in broader context

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.