Recombinant Arabidopsis thaliana CASP-like protein At3g50810 (At3g50810)

Shipped with Ice Packs
In Stock

Description

Introduction to CASP-like Proteins in Arabidopsis

The CASP protein family constitutes a crucial group of proteins in plants that play essential roles in cellular membrane organization and barrier formation. In Arabidopsis thaliana, approximately 39 genes have been identified as part of the CASP family (UPF0497), with the core CASP1/2/3/4/5 proteins known to be directly associated with Casparian strip formation in the root endodermis . The Casparian strip serves as a critical barrier in plant roots, regulating the movement of water and nutrients between the soil and vascular tissues.

CASP-like proteins, including At3g50810 (AtCASPL5C2), represent members of this extended protein family that share structural similarities with the core CASP proteins but may serve diverse and sometimes distinct physiological functions. Recent research suggests that CASP-like proteins may have roles beyond Casparian strip formation in roots, potentially indicating more fundamental functions in vascular tissue development and organization .

Involvement in Membrane Domain Organization

While specific research on At3g50810's exact function is limited in the provided sources, studies on related CASP-like proteins provide insights into their potential roles. CASP proteins are among the earliest known proteins responsible for the formation of Casparian strip membrane domains (CSDs) . These specialized membrane domains are critical for establishing cellular barriers that regulate the passage of molecules between different tissue compartments.

CASP-like proteins are believed to mediate membrane subdomain formation and potentially function in plasma membrane organization in various cell types beyond the endodermis . Their localization at specific membrane domains suggests they may serve as scaffolds for recruiting other proteins and components necessary for establishing specialized membrane structures.

Potential Role in Stress Responses

Research on related CASP-like proteins, such as ClCASPL from watermelon (Citrullus lanatus) and AtCASPL4C1 (At3g55390) from Arabidopsis, has revealed significant involvement in plant responses to environmental stresses, particularly cold stress . Transcriptomic analyses have shown that various abiotic stresses can result in significant up-regulation or down-regulation of numerous CASP and CASP-like genes .

For instance, knockout of AtCASPL4C1 resulted in enhanced cold tolerance in Arabidopsis, while overexpression of ClCASPL increased sensitivity to cold stress . This suggests that certain CASP-like proteins may function as negative regulators of cold stress tolerance. While the specific role of At3g50810 in stress responses has not been directly characterized in the provided sources, its membership in the CASP-like family suggests it may also contribute to stress response regulation.

Antibody Production and Immunological Studies

The purified recombinant protein can serve as an antigen for generating specific antibodies against At3g50810. Such antibodies are valuable tools for detecting and studying the endogenous protein in plant tissues, enabling researchers to investigate its expression patterns, subcellular localization, and potential changes in response to developmental or environmental cues.

Laboratory Handling and Reconstitution

Proper handling and reconstitution of the recombinant At3g50810 protein are essential for maintaining its structural integrity and functional properties in research applications. The recommended procedures for reconstitution and storage are as follows:

  1. Briefly centrifuge the vial prior to opening to bring contents to the bottom

  2. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% (50% is recommended as default)

  4. Aliquot the reconstituted protein for long-term storage at -20°C/-80°C

  5. Avoid repeated freeze-thaw cycles, as these can compromise protein quality

  6. For working aliquots, store at 4°C for up to one week

These guidelines help ensure the stability and functionality of the recombinant protein during laboratory use.

Phylogenetic Relationships

CASP-like proteins in Arabidopsis are classified into several subfamilies based on sequence similarity and evolutionary relationships. While the exact subfamily categorization of At3g50810 (AtCASPL5C2) is not explicitly stated in the provided sources, the nomenclature suggests it belongs to subfamily 5C, placing it in a different group from the well-characterized AtCASPL4C1 (At3g55390) .

Phylogenetic analyses of the CASP family in Arabidopsis have defined six major subfamilies, with the core CASP1-5 proteins forming a distinct clade associated with Casparian strip formation . The more diverse CASP-like proteins, including At3g50810, are distributed across other clades, reflecting their potential functional diversification.

Functional Diversification

Unlike the core CASP proteins (CASP1-5) that are primarily expressed in the root endodermis and directly involved in Casparian strip formation, CASP-like proteins often show broader expression patterns and may serve diverse functions . While some CASP-like proteins have been shown to influence Casparian strip formation indirectly, others appear to have entirely distinct roles in plant development and stress responses.

For example, the CASP-like protein AtCASPL4C1 influences plant growth dynamics, biomass accumulation, flowering time, and cold stress tolerance without significantly altering Casparian strip formation in roots . This functional diversification highlights the evolutionary adaptation of CASP-like proteins to serve various physiological roles beyond barrier formation.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributor.
Note: All protein shipments default to blue ice packs. If you require dry ice shipping, please contact us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us and we will prioritize development of the specified tag.
Synonyms
At3g50810; F18B3.90; CASP-like protein 5C2; AtCASPL5C2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At3g50810
Target Protein Sequence
MEHVPGSFGTSASFALRFGQTIFSAASLIFMCFDFDFYDFTTFCYLAMVMAIVTPWSILL ALTDTYSVLVKLLPQELRVLSIVFAGDFVLSFLSLGGACAVASATELLASADGKICDGSL CIQYQVSAALAFLCWFLLLASALFNFWSLPSLYY
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G50810

UniGene: At.35451

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Arabidopsis thaliana CASP-like protein At3g50810?

Arabidopsis thaliana CASP-like protein At3g50810 (AtCASPL5C2) is a membrane protein belonging to the Casparian strip membrane domain (CASP)-like protein family. This protein consists of 154 amino acids and is classified as part of the broader CASP protein superfamily . While traditional understanding places CASP proteins primarily in the context of Casparian strip formation in plant roots, research indicates that CASP-like proteins such as At3g50810 may have additional functional roles throughout the plant beyond Casparian strip formation, potentially indicating more fundamental roles in vascular tissue development and stress responses .

What are the known biological functions of At3g50810 and related CASP-like proteins?

Research indicates that CASP-like proteins, including At3g50810, play more diverse roles than initially thought. While the CASP protein family was first characterized for their function in Casparian strip formation in roots, studies of orthologous genes like AtCASPL4C1 reveal broader functional importance:

  • Stress response regulation: CASP-like proteins appear to be involved in cold tolerance mechanisms. Knockout of the orthologous gene AtCASPL4C1 in Arabidopsis resulted in elevated tolerance to cold stress, while overexpression of the watermelon ortholog ClCASPL increased cold sensitivity in Arabidopsis .

  • Growth regulation: AtCASPL4C1 knockout plants demonstrated altered growth dynamics, including faster growth, increased biomass production, and earlier flowering compared to wild-type plants .

  • Vascular development: Interestingly, despite CASP proteins' known role in Casparian strip formation, AtCASPL4C1 knockout plants did not display significant alterations in Casparian strip formation in roots, suggesting these proteins may have additional functions in vascular tissue beyond Casparian strip development .

These findings suggest that At3g50810 and related CASP-like proteins may function as regulatory components in multiple physiological processes, potentially serving as signaling mediators in stress responses and developmental pathways.

What are the optimal storage and handling conditions for recombinant At3g50810 protein?

For optimal preservation of recombinant At3g50810 protein activity and stability, the following storage and handling protocols are recommended:

  • Long-term storage: Store the lyophilized protein powder at -20°C to -80°C upon receipt .

  • Aliquoting: Proper aliquoting is essential for multiple use scenarios to prevent protein degradation from repeated freeze-thaw cycles .

  • Working storage: For ongoing experiments, store working aliquots at 4°C for up to one week. Avoid repeated freezing and thawing, as this significantly reduces protein activity .

  • Buffer conditions: The protein is typically provided in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain protein stability .

  • Pre-use preparation: Before opening, briefly centrifuge the vial to bring contents to the bottom and ensure all material is accessible .

What is the recommended reconstitution protocol for lyophilized At3g50810?

The following reconstitution protocol is recommended for optimal protein recovery and activity:

  • Centrifuge the product vial briefly before opening to collect all material at the bottom of the tube .

  • Reconstitute the lyophilized protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL .

  • For long-term storage of reconstituted protein, add glycerol to a final concentration of 5-50%. The recommended default glycerol concentration is 50% .

  • Prepare multiple small aliquots of the reconstituted protein to avoid repeated freeze-thaw cycles in future experiments .

  • Store reconstituted aliquots at -20°C to -80°C for long-term use .

When designing experiments, plan ahead to thaw only the amount of protein needed for immediate use to maintain optimal activity and prevent unnecessary degradation.

What expression systems have been successfully used for At3g50810 protein production?

The recombinant full-length Arabidopsis thaliana CASP-like protein At3g50810 has been successfully expressed in Escherichia coli expression systems . For the commercially available recombinant protein:

  • Expression construct: The full-length protein (amino acids 1-154) is typically fused to an N-terminal His tag to facilitate purification and detection .

  • Purification approach: Affinity chromatography utilizing the His tag is the standard method for purification, with protein purity typically greater than 90% as determined by SDS-PAGE .

How do genetic manipulations of At3g50810 and related CASP-like genes affect plant phenotypes?

Genetic manipulation studies of CASP-like genes have revealed several important phenotypic effects that provide insight into their biological functions:

These findings suggest that At3g50810 and related CASP-like proteins may function as negative regulators of plant growth and cold stress tolerance. The lack of obvious Casparian strip defects in knockout plants indicates that these proteins may have evolved specialized functions distinct from the core CASP proteins directly involved in Casparian strip formation.

What are the expression patterns of At3g50810 and related CASP-like genes?

Analysis of expression patterns of CASP-like genes provides important insights into their potential biological functions:

  • Tissue distribution: Expression analysis using β-glucuronidase (GUS) reporter constructs revealed that AtCASPL4C1, an ortholog related to At3g50810, is widely expressed across a variety of plant organs, suggesting broad physiological roles beyond Casparian strip formation in roots .

  • Stress response: AtCASPL4C1 expression is cold-inducible, with increased expression observed under cold stress conditions. Similarly, ClCASPL (the watermelon ortholog) was identified as a cold-induced transcript .

  • Cellular localization: Fluorescence microscopy analysis of CASP-like proteins fused to GFP demonstrated that these proteins localize to the plasma membrane, consistent with their predicted transmembrane domains and potential roles in membrane organization or signaling .

The broad expression pattern across multiple tissues suggests that CASP-like proteins, including At3g50810, may have evolved regulatory functions beyond their ancestral roles in specialized root barrier tissues, potentially influencing whole-plant responses to environmental stresses such as cold.

How do CASP-like proteins relate to plant stress tolerance mechanisms?

Research on CASP-like proteins has revealed important connections to plant stress tolerance mechanisms, particularly in response to cold stress:

  • Negative regulation of cold tolerance: Genetic evidence suggests that certain CASP-like proteins function as negative regulators of cold stress tolerance:

    • Knockout of AtCASPL4C1 enhanced cold tolerance in Arabidopsis

    • Overexpression of ClCASPL increased cold sensitivity

  • Cold-responsive expression: Both AtCASPL4C1 in Arabidopsis and ClCASPL in watermelon show cold-inducible expression patterns, suggesting they participate in cold stress response pathways .

  • Potential signaling roles: The plasma membrane localization of CASP-like proteins, combined with their effects on stress tolerance, suggests they might function in stress signaling pathways, potentially by:

    • Organizing membrane microdomains that affect signaling protein clustering

    • Interacting with stress-responsive signaling components

    • Influencing membrane properties that affect cellular responses to temperature changes

These findings suggest that CASP-like proteins, including At3g50810, may represent important targets for engineering improved cold tolerance in agricultural crops through biotechnological approaches.

What are the key considerations for studying At3g50810 protein interactions?

When designing experiments to study At3g50810 protein interactions, researchers should consider several important factors:

  • Protein preparation:

    • Use freshly reconstituted protein whenever possible

    • Ensure proper buffer conditions that maintain native protein conformation

    • Consider using the His-tagged version for pull-down experiments

  • Experimental approaches:

    • Co-immunoprecipitation using anti-His antibodies for the recombinant protein

    • Yeast two-hybrid screening against Arabidopsis cDNA libraries

    • Bimolecular fluorescence complementation (BiFC) in plant protoplasts to visualize interactions in vivo

    • Proximity-based labeling approaches (BioID or TurboID) to identify proximal interacting partners in membrane microdomains

  • Controls and validation:

    • Include proper negative controls (unrelated membrane proteins) to account for non-specific interactions

    • Validate potential interactions using multiple independent techniques

    • Consider competitive binding assays to determine specificity of interactions

  • Physiological relevance:

    • Test interactions under different conditions (standard growth, cold stress) given the protein's role in stress responses

    • Compare interaction patterns between wild-type At3g50810 and mutant versions with altered function

The membrane localization of At3g50810 presents specific challenges for interaction studies, requiring careful consideration of detergent conditions that solubilize the protein while preserving native interactions.

How can researchers effectively analyze phenotypic data from At3g50810 mutant studies?

Based on previous studies with related CASP-like proteins, researchers should implement the following approaches when analyzing phenotypic data from At3g50810 mutant studies:

  • Growth parameter analysis:

    • Track multiple growth parameters simultaneously (height, biomass, leaf area, flowering time)

    • Implement time-course measurements to capture dynamic growth differences

    • Use high-throughput phenotyping platforms when available for more detailed growth analysis

  • Stress response assessment:

    • Test multiple stress conditions beyond cold (drought, salt, heat) to determine specificity

    • Measure both physiological parameters (electrolyte leakage, photosynthetic efficiency) and molecular markers (stress-responsive gene expression)

    • Compare results between knockout and overexpression lines to establish functional relationships

  • Statistical approaches:

    • Employ repeated measures ANOVA for time-course experiments

    • Use sufficient biological replicates (n≥15) for growth and stress experiments to account for natural variation

    • Consider multivariate statistical approaches to identify patterns across multiple phenotypic parameters

  • Genetic background considerations:

    • Always compare mutants to their appropriate wild-type background

    • Consider creating multiple independent transgenic lines to control for position effects

    • Perform complementation experiments to confirm phenotypes are specifically due to At3g50810 manipulation

What are the promising areas for further investigation of At3g50810 function?

Based on current knowledge of CASP-like proteins, several promising research directions could advance understanding of At3g50810 function:

  • Molecular mechanism of cold tolerance regulation:

    • Identify direct interaction partners under normal and cold stress conditions

    • Determine if At3g50810 undergoes post-translational modifications in response to cold

    • Investigate whether At3g50810 affects membrane fluidity or organization during cold stress

  • Broader roles in plant development:

    • Examine expression patterns across different developmental stages

    • Investigate potential roles in vascular tissue development beyond Casparian strip formation

    • Explore functional relationships with known developmental regulators

  • Comparative studies across CASP-like protein family:

    • Perform systematic functional analysis of multiple CASP-like proteins to identify specialized vs. redundant functions

    • Investigate evolutionary relationships and functional divergence within the family

    • Determine tissue-specific roles of different family members

  • Biotechnological applications:

    • Explore potential for improving cold tolerance in crops through manipulation of At3g50810 orthologs

    • Investigate whether CASP-like proteins could serve as targets for enhancing other stress tolerance traits

    • Develop synthetic biology approaches using CASP-like proteins as building blocks for engineered membrane domains

These research directions could significantly advance understanding of At3g50810 function while potentially contributing to agricultural improvement through enhanced stress tolerance.

What methodological advances could enhance studies of At3g50810?

Several emerging methodological approaches could significantly advance studies of At3g50810 and related CASP-like proteins:

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize membrane microdomain organization

    • Single-molecule tracking to analyze dynamics of At3g50810 in living cells

    • Correlative light and electron microscopy to link protein localization with ultrastructural features

  • Protein structure determination:

    • Cryo-electron microscopy for membrane protein structure determination

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

    • In silico structure prediction using AlphaFold2 combined with experimental validation

  • Genome editing approaches:

    • CRISPR-Cas9 base editing for precise modification of specific amino acids

    • Prime editing for introducing specific mutations without double-strand breaks

    • Multiplexed editing to simultaneously modify multiple CASP-like family members

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Network analysis to position At3g50810 within larger regulatory frameworks

    • Mathematical modeling of membrane domain formation and dynamics

Implementation of these advanced methodologies could overcome current limitations in studying membrane-localized proteins like At3g50810 and provide unprecedented insights into their molecular functions and physiological roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.