Recombinant Arabidopsis thaliana CASP-like protein At3g53850 (At3g53850)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics

  • Sequence: The 154-amino-acid sequence begins with MKKLLGGPGTVCGLLLRIGQCASAAASIGVMVSAKEFSVHTAFCYLIASMGLQLLWSFGL... .

  • Structure: Predicted four transmembrane domains, typical of CASP-family proteins .

  • Stability: Hydrophobic residues dominate (grand average hydropathicity >0), with an instability index <40, indicating high stability .

Functional Insights

At3g53850 is implicated in:

  • Casparian Strip Formation: CASP proteins scaffold membrane microdomains to localize lignin-synthesizing enzymes (e.g., peroxidases) and NADPH oxidases, enabling spatially restricted lignification .

  • Membrane Domain Organization: Facilitates fusion of secretory foci into continuous bands by suppressing EXO70A1-mediated secretion at initial sites .

  • Stress Responses: CASP-like proteins may regulate growth under abiotic stress, though At3g53850’s direct role remains under investigation .

Research Applications

  • Biochemical Studies: Used to analyze protein-protein interactions and membrane domain dynamics .

  • Structural Analysis: Recombinant production enables crystallization and electron microscopy studies .

  • Antibody Production: Commercial ELISA kits utilize this protein for antibody validation .

Key Research Findings

  1. Comparative Genomics: At3g53850 clusters within the CASP_like-III subfamily, sharing homology with rice OsCASP_like proteins. Both exhibit similar transmembrane architectures but divergent regulatory elements (e.g., hormone-responsive motifs) .

  2. Mutant Phenotypes: Atcasp knockouts show disrupted lignin patterning, though At3g53850-specific mutants have not yet reported severe developmental defects, suggesting functional redundancy .

  3. Expression Systems: Arabidopsis-based platforms yield ~0.4 mg protein/g fresh weight, outperforming E. coli for membrane protein assembly .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand that you may have specific requirements. If so, please indicate your preferred format when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our standard shipping method utilizes normal blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your specifications.
Synonyms
At3g53850; F3L17_30; CASP-like protein 5B2; AtCASPL5B2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At3g53850
Target Protein Sequence
MKKLLGGPGTVCGLLLRIGQCASAAASIGVMVSAKEFSVHTAFCYLIASMGLQLLWSFGL ACLDVYALRGKKDLQNPILVSLFVVGDWVTAMLSLAAACSSAGVVVLYEKDIKYCNTQSQ YPCLRYEVAVALSFVTWIQIAVSSHVTFWILASV
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G53850

UniGene: At.26407

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the stele of the root.

Q&A

How is recombinant At3g53850 protein typically expressed and purified for research applications?

Recombinant At3g53850 protein can be expressed using standard molecular biology techniques. The protein is typically stored in a Tris-based buffer with 50% glycerol optimized specifically for this protein's stability . For experimental work, expression constructs are designed to include the full-length sequence (region 1-154) along with a tag for purification and detection purposes . After expression, the protein is typically stored at -20°C, though for extended storage periods, conservation at -80°C is recommended. Working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided to maintain protein integrity .

What membrane localization patterns does At3g53850 exhibit in plant cells?

Fluorescence microscopy analysis of CASP-like proteins, including At3g53850, reveals localization to the plasma membrane, consistent with their roles in membrane domain formation . Unlike the strict localization of the core CASP proteins (CASP1-5) to the Casparian Strip Domain (CSD) in endodermal cells, CASP-like proteins such as At3g53850 may show more diverse localization patterns. Fusion proteins with fluorescent tags (e.g., GFP) can be used to visualize this localization in vivo, providing insight into potential functional domains within cellular membranes .

How do At3g53850 expression patterns vary across different tissues and developmental stages?

Expression analysis using β-glucuronidase (GUS) reporter systems reveals that certain CASP-like proteins are widely expressed across various plant organs, suggesting functions beyond the specialized Casparian strip formation . At3g53850 likely follows similar patterns, with expression potentially modulated by environmental factors such as temperature. For instance, orthologous CASP-like genes have been shown to be cold-inducible, suggesting At3g53850 may also respond to temperature stress . This broad expression pattern indicates that CASP-like proteins may have fundamental roles in vascular tissues beyond their originally identified functions.

What experimental approaches are most effective for investigating At3g53850 protein-protein interactions in membrane microdomains?

Methodology for membrane protein interaction studies:

When investigating At3g53850 protein-protein interactions, researchers should consider multiple complementary approaches:

  • Co-immunoprecipitation with membrane fractionation: This technique requires careful membrane solubilization using mild detergents that preserve protein-protein interactions while extracting At3g53850 from the lipid bilayer. Sample preparation should include crosslinking steps to stabilize transient interactions.

  • FRET/FLIM analysis: Fluorescence resonance energy transfer (FRET) coupled with fluorescence lifetime imaging microscopy (FLIM) provides spatial resolution of protein interactions in living cells. Constructs fusing At3g53850 with appropriate fluorophore pairs (e.g., CFP/YFP) should be designed with attention to the protein's transmembrane topology to avoid disrupting native interactions.

  • Split-ubiquitin yeast two-hybrid assay: Unlike conventional Y2H systems, the split-ubiquitin approach is specifically designed for membrane proteins like At3g53850. This system has proven valuable for identifying interaction partners of CASP family proteins in previous studies .

  • Proximity-based labeling approaches: BioID or APEX2 fusions with At3g53850 can identify proximal proteins in native cellular contexts. These methods are particularly valuable for capturing interactions that may be disrupted during conventional co-IP procedures.

When interpreting interaction data, researchers should consider that mutations in conserved residues (particularly in TM3) can significantly affect protein folding and stability, potentially leading to false negatives in interaction studies .

How can researchers effectively evaluate the functional redundancy between At3g53850 and other CASP-like proteins?

Comprehensive approaches to functional redundancy assessment:

To evaluate functional redundancy between At3g53850 and other CASP-like proteins:

  • Generate and characterize multiple mutant combinations: Single T-DNA knockout lines may show subtle or no phenotypes due to functional redundancy. Creating double, triple, or higher-order mutants of phylogenetically related CASP-like genes is essential. The following experimental design is recommended:

Mutant CombinationGenotyping MarkersExpected Phenotypic Analysis
At3g53850 single knockoutT-DNA insertion verificationGrowth parameters, stress responses
At3g53850 + closest homologMultiplex PCR confirmationEnhanced phenotypic severity
Higher-order mutantsCRISPR-Cas9 targeted mutationsPotential synthetic phenotypes
  • Complementation studies: Cross-complementation experiments using At3g53850 and other CASP-like genes under native and heterologous promoters can reveal functional equivalence or specialization.

  • Domain swap experiments: Constructing chimeric proteins by exchanging domains between At3g53850 and other CASP family members can identify regions responsible for functional specificity or redundancy .

  • Expression correlation analysis: Examining co-expression patterns across tissues and conditions can identify genes likely to function redundantly with At3g53850.

Recent studies with CASP-like proteins have revealed unexpected roles beyond Casparian strip formation, such as in cold tolerance, suggesting that seemingly redundant family members may have evolved specialized functions in different environmental responses .

What are the best experimental approaches to resolve contradictory findings regarding At3g53850 function in stress responses?

Resolving contradictory findings in CASP-like protein research:

Contradictory results regarding At3g53850 function, particularly in stress responses, can be addressed through:

  • Context-specific experimental design: Many contradictions in the literature arise from insufficiently specified experimental contexts . Researchers should carefully document and control:

    • Plant accession/ecotype

    • Growth conditions (light intensity, photoperiod, temperature, humidity)

    • Developmental stage during treatment

    • Precise stress parameters (duration, intensity)

  • Cellular resolution studies: Bulk tissue analyses may mask cell type-specific responses. Single-cell RNA-seq or cell type-specific expression profiling can reveal whether At3g53850 functions differently across cell types.

  • Temporal resolution: Time-course experiments with fine resolution can determine whether apparently contradictory results reflect different phases of a dynamic response.

  • Systematic literature analysis: Researchers should categorize apparently contradictory findings according to:

    • Internal factors (species, developmental stage, tissue specificity)

    • External factors (environmental conditions, stress intensity)

    • Methodology differences (knockout vs. knockdown, overexpression systems)

For example, studies of CASP-like proteins have shown opposing effects on cold tolerance, with AtCASPL4C1 knockout plants showing elevated cold tolerance while ClCASPL overexpression increases cold sensitivity . These apparently contradictory findings likely reflect complex tissue-specific and condition-dependent roles that require careful experimental design to unravel.

What molecular mechanisms underlie the potential role of At3g53850 in cold stress responses?

Molecular mechanisms in cold stress response:

Based on studies of orthologous CASP-like proteins, several potential mechanisms may explain At3g53850 involvement in cold stress:

  • Membrane microdomain organization: At3g53850 may regulate membrane fluidity under cold conditions by organizing specific lipid/protein microdomains that influence membrane dynamics. This function relates to the protein's conserved transmembrane domains and potential interactions with membrane components.

  • Signaling pathway modulation: The protein likely influences signal transduction pathways related to cold stress response, possibly by:

    • Regulating calcium influx across the plasma membrane

    • Modulating hormone signaling components

    • Interacting with kinase-associated stress signaling networks

  • Growth regulation: Knockout studies of the orthologous AtCASPL4C1 revealed altered growth dynamics, increased biomass, and earlier flowering . At3g53850 may similarly regulate growth-defense trade-offs during cold stress.

  • Vascular tissue functioning: The expression patterns of CASP-like proteins suggest roles in vascular tissue beyond Casparian strip formation . At3g53850 might influence long-distance signaling or resource allocation during cold stress.

To investigate these mechanisms, researchers should employ:

  • Lipidomic analyses to characterize membrane composition changes

  • Phosphoproteomic approaches to identify altered signaling pathways

  • Transcriptomic profiling under varying temperature conditions

  • Metabolic flux analysis to detect changes in resource allocation

How does the evolutionary conservation of specific domains in At3g53850 relate to its functional specialization?

Evolutionary conservation analysis for functional insights:

The evolutionary conservation pattern of At3g53850 provides critical insights into its functional specialization:

  • Transmembrane domain conservation: The high conservation of arginine in TM1 and aspartic acid in TM3 across the CASPL family suggests these residues are essential for proper protein folding, membrane insertion, or protein-protein interactions . Experimental evidence indicates that mutation of the conserved Asp residue in TM3 (e.g., D134H in AtCASP1) prevents proper protein expression, suggesting critical structural roles .

  • Extracellular loop variability: The extracellular loops show greater sequence divergence, with some CASP proteins containing a distinctive nine-amino acid signature (ESLPFFTQF) in the first extracellular loop that is conserved in spermatophytes but absent in more basal plant lineages . This signature may relate to endodermis-specific functions, as demonstrated by the ability of orthologous proteins containing this signature to localize correctly to the Casparian Strip Domain when expressed in Arabidopsis .

  • Phylogenetic distribution:

Plant LineageConservation PatternFunctional Implication
AngiospermsFull CASP repertoire with specialized membersDiverse functions in various tissues
GymnospermsPresent with nine-amino acid EL1 signatureSpecialized endodermal functions
FernsBasic CASP structureOriginal membrane domain functions
Mosses/LiverwortsReduced or absent nine-amino acid signatureLack of specialized Casparian strip function
Green algaeBasic MARVEL-like proteinsAncestral membrane organization

To investigate structure-function relationships experimentally, researchers should consider:

  • Targeted mutagenesis of conserved residues

  • Domain swapping between differently specialized CASP family members

  • Heterologous expression of orthologous proteins from different plant lineages

What are the optimal protocols for generating At3g53850 constructs for subcellular localization studies?

Optimized construct design protocol:

For successful subcellular localization studies of At3g53850:

How can researchers accurately quantify changes in At3g53850 expression under different experimental conditions?

Expression analysis methodology:

For accurate quantification of At3g53850 expression:

  • RNA-based methods:

    • RT-qPCR: Design primers spanning exon-exon junctions to avoid genomic DNA amplification. Normalize expression using multiple reference genes validated for stability under your specific experimental conditions.

    • RNA-seq: Provides comprehensive expression analysis and allows for identification of alternatively spliced variants.

  • Protein-based methods:

    • Western blotting: Requires careful membrane protein extraction protocols and specific antibodies against At3g53850 or epitope tags if using recombinant proteins.

    • Mass spectrometry: For absolute quantification, consider AQUA peptides or TMT labeling approaches.

  • Reporter-based systems:

    • Transcriptional fusions: Construct promoter:GUS or promoter:LUC reporters for tissue-specific expression pattern analysis.

    • Translational fusions: Full gene fusions with fluorescent proteins allow quantification of both expression level and protein localization .

  • Experimental design considerations:

    • Include time-course analysis to capture expression dynamics

    • Analyze expression in different tissues/cell types

    • Compare expression patterns under various stress conditions (especially cold stress, given the known cold-inducibility of orthologous genes)

What are the most effective strategies for functional characterization of At3g53850 using CRISPR/Cas9-mediated gene editing?

CRISPR/Cas9 gene editing strategy:

For effective functional characterization using CRISPR/Cas9:

  • Guide RNA design:

    • Target early exons to maximize disruption probability

    • Select target sites with minimal off-target potential using tools like CRISPR-P

    • Design multiple gRNAs targeting different regions of At3g53850 to increase editing efficiency

  • Validation approach:

    • Confirm mutations by sequencing both genomic DNA and cDNA to verify effects on transcript

    • Check protein levels using antibodies or tagged lines

    • Analyze potential off-target effects in silico and experimentally in critical candidate sites

  • Phenotypic analysis pipeline for At3g53850 mutants:

Analysis TypeMethodsExpected Insights
Growth phenotypingMeasure biomass, flowering time, root architectureDevelopmental role assessment
Stress responsesCold, osmotic, ionic stress tolerance assaysEnvironmental adaptation functions
Cellular imagingMembrane domain visualization, cell wall integrity analysisSubcellular function determination
Molecular profilingTranscriptomics, proteomics, metabolomicsDownstream pathways and processes
  • Advanced genetic manipulation:

    • Generate tissue-specific knockouts using cell type-specific promoters driving Cas9

    • Create conditional mutants using inducible CRISPR systems

    • Develop knock-in lines with specific point mutations to test the functional significance of conserved residues

What techniques can researchers use to investigate protein-membrane interactions of At3g53850?

Membrane interaction analysis methodology:

To investigate At3g53850 interactions with membrane components:

  • Biophysical approaches:

    • Fluorescence recovery after photobleaching (FRAP): Measure protein mobility within membranes to determine interaction dynamics

    • Detergent resistance analysis: Fractionate membranes to identify association with specialized domains like lipid rafts

    • Microscale thermophoresis: Quantify interactions between purified At3g53850 and specific lipids

  • Biochemical methods:

    • Crosslinking mass spectrometry: Identify proximal proteins and lipids in native membrane environments

    • Lipid overlay assays: Determine specific lipid binding preferences of At3g53850

    • Blue-native PAGE: Analyze native membrane protein complexes containing At3g53850

  • Imaging techniques:

    • Super-resolution microscopy (STORM, PALM): Visualize nanoscale organization of At3g53850 within membrane domains

    • Correlative light and electron microscopy (CLEM): Connect fluorescence localization with ultrastructural context

  • Computational approaches:

    • Molecular dynamics simulations: Model At3g53850 interactions with membrane lipids

    • Protein-lipid docking: Predict specific binding sites for membrane components

The effectiveness of these techniques has been demonstrated in studies of CASP proteins, where the formation of membrane domains and interaction with cell wall material has been characterized .

What unresolved questions persist regarding the role of At3g53850 in plant development and stress responses?

Several critical questions remain unanswered regarding At3g53850:

  • Developmental role beyond Casparian strip formation: While knockout studies of orthologous genes have shown altered growth dynamics, the specific developmental pathways influenced by At3g53850 remain poorly characterized . Future research should investigate whether At3g53850 regulates developmental transitions, cell differentiation, or organ formation.

  • Environmental response specificity: Although cold stress responses have been documented for orthologous CASP-like proteins, the full spectrum of environmental responses modulated by At3g53850 requires systematic investigation . Research should address whether At3g53850 responds to multiple abiotic stresses or has evolved specific functions in cold adaptation.

  • Tissue-specific functions: The broad expression pattern of CASP-like proteins suggests diverse roles across tissues, but tissue-specific functions remain largely unexplored . Cell type-specific knockout studies combined with transcriptomic analysis could reveal these specialized roles.

  • Evolutionary adaptation: The presence of CASP-like proteins across plant lineages with varying environmental adaptations suggests potential roles in evolutionary adaptation to different habitats . Comparative studies across species adapted to different environments could provide insights into functional specialization.

  • Protein interaction network: The full complement of proteins interacting with At3g53850 in different tissues and conditions remains undetermined. Interactome studies under various conditions could reveal context-specific protein complexes.

How can researchers reconcile contradictory findings regarding the function of CASP-like proteins in different plant species?

Strategies for resolving cross-species contradictions:

To reconcile contradictory findings across plant species:

  • Standardized experimental systems: Establish common experimental protocols and reporting standards to facilitate direct comparisons between studies on CASP-like proteins from different species.

  • Complementation studies: Express CASP-like proteins from different species in a common genetic background (e.g., Arabidopsis mutants) to directly test functional conservation or divergence.

  • Domain function analysis: Contradictions may stem from subtle differences in protein domains. Systematic domain swapping between orthologs can identify regions responsible for species-specific functions.

  • Context categorization: Analyze contradictory findings using a structured framework that considers factors such as:

    • Internal context: Species, developmental stage, genetic background

    • External context: Environmental conditions, stress parameters

    • Methodological context: Experimental approach, measurement techniques

  • Phylogenetic framework: Interpret functional differences in light of evolutionary relationships, considering that:

    • Closely related orthologs may have similar functions but different regulation

    • Distant orthologs may have undergone substantial functional divergence

    • Paralogs within a species may have evolved specialized functions

For example, contradictory findings regarding cold tolerance (AtCASPL4C1 knockout increasing tolerance while ClCASPL overexpression decreases tolerance) likely reflect species-specific adaptations that require integrated analysis across multiple experimental systems .

What emerging technologies could advance our understanding of At3g53850 function in membrane domain organization?

Emerging technologies for membrane domain research:

Several cutting-edge technologies show promise for advancing our understanding of At3g53850 function:

  • Advanced imaging approaches:

    • Expansion microscopy: Provides improved resolution of membrane domain organization

    • Lattice light-sheet microscopy: Enables long-term live-cell imaging with minimal phototoxicity

    • Cryo-electron tomography: Visualizes membrane proteins in native environments at near-atomic resolution

  • Single-cell multi-omics:

    • Single-cell proteomics: Reveals cell-specific protein expression patterns

    • Spatial transcriptomics: Maps gene expression to specific cells within intact tissues

    • Single-cell metabolomics: Connects At3g53850 function to metabolic changes at cellular resolution

  • Proximity labeling advances:

    • TurboID and miniTurbo: Faster biotin ligase variants for improved temporal resolution of protein interactions

    • Split-TurboID: Enables detection of protein-protein interactions with spatial precision

    • PerOxiSed: Organelle-specific proximity labeling for compartment-resolved interactomics

  • Synthetic biology approaches:

    • Optogenetic control of At3g53850 expression or localization

    • Engineered membrane domain systems to test At3g53850 function in defined contexts

    • CRISPR activation/interference for temporal control of gene expression

  • Computational methods:

    • Deep learning for image analysis of membrane domain organization

    • Integrative modeling combining structural, interactomic, and functional data

    • Network analysis approaches to place At3g53850 in broader cellular pathways

Implementation of these technologies will require interdisciplinary collaboration but promises to resolve longstanding questions about the precise mechanisms by which CASP-like proteins organize membrane domains and influence plant development and stress responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.