Sequence: The 154-amino-acid sequence begins with MKKLLGGPGTVCGLLLRIGQCASAAASIGVMVSAKEFSVHTAFCYLIASMGLQLLWSFGL... .
Structure: Predicted four transmembrane domains, typical of CASP-family proteins .
Stability: Hydrophobic residues dominate (grand average hydropathicity >0), with an instability index <40, indicating high stability .
At3g53850 is implicated in:
Casparian Strip Formation: CASP proteins scaffold membrane microdomains to localize lignin-synthesizing enzymes (e.g., peroxidases) and NADPH oxidases, enabling spatially restricted lignification .
Membrane Domain Organization: Facilitates fusion of secretory foci into continuous bands by suppressing EXO70A1-mediated secretion at initial sites .
Stress Responses: CASP-like proteins may regulate growth under abiotic stress, though At3g53850’s direct role remains under investigation .
Biochemical Studies: Used to analyze protein-protein interactions and membrane domain dynamics .
Structural Analysis: Recombinant production enables crystallization and electron microscopy studies .
Antibody Production: Commercial ELISA kits utilize this protein for antibody validation .
Comparative Genomics: At3g53850 clusters within the CASP_like-III subfamily, sharing homology with rice OsCASP_like proteins. Both exhibit similar transmembrane architectures but divergent regulatory elements (e.g., hormone-responsive motifs) .
Mutant Phenotypes: Atcasp knockouts show disrupted lignin patterning, though At3g53850-specific mutants have not yet reported severe developmental defects, suggesting functional redundancy .
Expression Systems: Arabidopsis-based platforms yield ~0.4 mg protein/g fresh weight, outperforming E. coli for membrane protein assembly .
KEGG: ath:AT3G53850
UniGene: At.26407
Recombinant At3g53850 protein can be expressed using standard molecular biology techniques. The protein is typically stored in a Tris-based buffer with 50% glycerol optimized specifically for this protein's stability . For experimental work, expression constructs are designed to include the full-length sequence (region 1-154) along with a tag for purification and detection purposes . After expression, the protein is typically stored at -20°C, though for extended storage periods, conservation at -80°C is recommended. Working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided to maintain protein integrity .
Fluorescence microscopy analysis of CASP-like proteins, including At3g53850, reveals localization to the plasma membrane, consistent with their roles in membrane domain formation . Unlike the strict localization of the core CASP proteins (CASP1-5) to the Casparian Strip Domain (CSD) in endodermal cells, CASP-like proteins such as At3g53850 may show more diverse localization patterns. Fusion proteins with fluorescent tags (e.g., GFP) can be used to visualize this localization in vivo, providing insight into potential functional domains within cellular membranes .
Expression analysis using β-glucuronidase (GUS) reporter systems reveals that certain CASP-like proteins are widely expressed across various plant organs, suggesting functions beyond the specialized Casparian strip formation . At3g53850 likely follows similar patterns, with expression potentially modulated by environmental factors such as temperature. For instance, orthologous CASP-like genes have been shown to be cold-inducible, suggesting At3g53850 may also respond to temperature stress . This broad expression pattern indicates that CASP-like proteins may have fundamental roles in vascular tissues beyond their originally identified functions.
Methodology for membrane protein interaction studies:
When investigating At3g53850 protein-protein interactions, researchers should consider multiple complementary approaches:
Co-immunoprecipitation with membrane fractionation: This technique requires careful membrane solubilization using mild detergents that preserve protein-protein interactions while extracting At3g53850 from the lipid bilayer. Sample preparation should include crosslinking steps to stabilize transient interactions.
FRET/FLIM analysis: Fluorescence resonance energy transfer (FRET) coupled with fluorescence lifetime imaging microscopy (FLIM) provides spatial resolution of protein interactions in living cells. Constructs fusing At3g53850 with appropriate fluorophore pairs (e.g., CFP/YFP) should be designed with attention to the protein's transmembrane topology to avoid disrupting native interactions.
Split-ubiquitin yeast two-hybrid assay: Unlike conventional Y2H systems, the split-ubiquitin approach is specifically designed for membrane proteins like At3g53850. This system has proven valuable for identifying interaction partners of CASP family proteins in previous studies .
Proximity-based labeling approaches: BioID or APEX2 fusions with At3g53850 can identify proximal proteins in native cellular contexts. These methods are particularly valuable for capturing interactions that may be disrupted during conventional co-IP procedures.
When interpreting interaction data, researchers should consider that mutations in conserved residues (particularly in TM3) can significantly affect protein folding and stability, potentially leading to false negatives in interaction studies .
Comprehensive approaches to functional redundancy assessment:
To evaluate functional redundancy between At3g53850 and other CASP-like proteins:
Generate and characterize multiple mutant combinations: Single T-DNA knockout lines may show subtle or no phenotypes due to functional redundancy. Creating double, triple, or higher-order mutants of phylogenetically related CASP-like genes is essential. The following experimental design is recommended:
| Mutant Combination | Genotyping Markers | Expected Phenotypic Analysis |
|---|---|---|
| At3g53850 single knockout | T-DNA insertion verification | Growth parameters, stress responses |
| At3g53850 + closest homolog | Multiplex PCR confirmation | Enhanced phenotypic severity |
| Higher-order mutants | CRISPR-Cas9 targeted mutations | Potential synthetic phenotypes |
Complementation studies: Cross-complementation experiments using At3g53850 and other CASP-like genes under native and heterologous promoters can reveal functional equivalence or specialization.
Domain swap experiments: Constructing chimeric proteins by exchanging domains between At3g53850 and other CASP family members can identify regions responsible for functional specificity or redundancy .
Expression correlation analysis: Examining co-expression patterns across tissues and conditions can identify genes likely to function redundantly with At3g53850.
Recent studies with CASP-like proteins have revealed unexpected roles beyond Casparian strip formation, such as in cold tolerance, suggesting that seemingly redundant family members may have evolved specialized functions in different environmental responses .
Resolving contradictory findings in CASP-like protein research:
Contradictory results regarding At3g53850 function, particularly in stress responses, can be addressed through:
Context-specific experimental design: Many contradictions in the literature arise from insufficiently specified experimental contexts . Researchers should carefully document and control:
Plant accession/ecotype
Growth conditions (light intensity, photoperiod, temperature, humidity)
Developmental stage during treatment
Precise stress parameters (duration, intensity)
Cellular resolution studies: Bulk tissue analyses may mask cell type-specific responses. Single-cell RNA-seq or cell type-specific expression profiling can reveal whether At3g53850 functions differently across cell types.
Temporal resolution: Time-course experiments with fine resolution can determine whether apparently contradictory results reflect different phases of a dynamic response.
Systematic literature analysis: Researchers should categorize apparently contradictory findings according to:
For example, studies of CASP-like proteins have shown opposing effects on cold tolerance, with AtCASPL4C1 knockout plants showing elevated cold tolerance while ClCASPL overexpression increases cold sensitivity . These apparently contradictory findings likely reflect complex tissue-specific and condition-dependent roles that require careful experimental design to unravel.
Molecular mechanisms in cold stress response:
Based on studies of orthologous CASP-like proteins, several potential mechanisms may explain At3g53850 involvement in cold stress:
Membrane microdomain organization: At3g53850 may regulate membrane fluidity under cold conditions by organizing specific lipid/protein microdomains that influence membrane dynamics. This function relates to the protein's conserved transmembrane domains and potential interactions with membrane components.
Signaling pathway modulation: The protein likely influences signal transduction pathways related to cold stress response, possibly by:
Regulating calcium influx across the plasma membrane
Modulating hormone signaling components
Interacting with kinase-associated stress signaling networks
Growth regulation: Knockout studies of the orthologous AtCASPL4C1 revealed altered growth dynamics, increased biomass, and earlier flowering . At3g53850 may similarly regulate growth-defense trade-offs during cold stress.
Vascular tissue functioning: The expression patterns of CASP-like proteins suggest roles in vascular tissue beyond Casparian strip formation . At3g53850 might influence long-distance signaling or resource allocation during cold stress.
To investigate these mechanisms, researchers should employ:
Lipidomic analyses to characterize membrane composition changes
Phosphoproteomic approaches to identify altered signaling pathways
Transcriptomic profiling under varying temperature conditions
Metabolic flux analysis to detect changes in resource allocation
Evolutionary conservation analysis for functional insights:
The evolutionary conservation pattern of At3g53850 provides critical insights into its functional specialization:
Transmembrane domain conservation: The high conservation of arginine in TM1 and aspartic acid in TM3 across the CASPL family suggests these residues are essential for proper protein folding, membrane insertion, or protein-protein interactions . Experimental evidence indicates that mutation of the conserved Asp residue in TM3 (e.g., D134H in AtCASP1) prevents proper protein expression, suggesting critical structural roles .
Extracellular loop variability: The extracellular loops show greater sequence divergence, with some CASP proteins containing a distinctive nine-amino acid signature (ESLPFFTQF) in the first extracellular loop that is conserved in spermatophytes but absent in more basal plant lineages . This signature may relate to endodermis-specific functions, as demonstrated by the ability of orthologous proteins containing this signature to localize correctly to the Casparian Strip Domain when expressed in Arabidopsis .
Phylogenetic distribution:
| Plant Lineage | Conservation Pattern | Functional Implication |
|---|---|---|
| Angiosperms | Full CASP repertoire with specialized members | Diverse functions in various tissues |
| Gymnosperms | Present with nine-amino acid EL1 signature | Specialized endodermal functions |
| Ferns | Basic CASP structure | Original membrane domain functions |
| Mosses/Liverworts | Reduced or absent nine-amino acid signature | Lack of specialized Casparian strip function |
| Green algae | Basic MARVEL-like proteins | Ancestral membrane organization |
To investigate structure-function relationships experimentally, researchers should consider:
Targeted mutagenesis of conserved residues
Domain swapping between differently specialized CASP family members
Heterologous expression of orthologous proteins from different plant lineages
Optimized construct design protocol:
For successful subcellular localization studies of At3g53850:
Expression analysis methodology:
For accurate quantification of At3g53850 expression:
RNA-based methods:
RT-qPCR: Design primers spanning exon-exon junctions to avoid genomic DNA amplification. Normalize expression using multiple reference genes validated for stability under your specific experimental conditions.
RNA-seq: Provides comprehensive expression analysis and allows for identification of alternatively spliced variants.
Protein-based methods:
Western blotting: Requires careful membrane protein extraction protocols and specific antibodies against At3g53850 or epitope tags if using recombinant proteins.
Mass spectrometry: For absolute quantification, consider AQUA peptides or TMT labeling approaches.
Reporter-based systems:
Experimental design considerations:
CRISPR/Cas9 gene editing strategy:
For effective functional characterization using CRISPR/Cas9:
Guide RNA design:
Target early exons to maximize disruption probability
Select target sites with minimal off-target potential using tools like CRISPR-P
Design multiple gRNAs targeting different regions of At3g53850 to increase editing efficiency
Validation approach:
Confirm mutations by sequencing both genomic DNA and cDNA to verify effects on transcript
Check protein levels using antibodies or tagged lines
Analyze potential off-target effects in silico and experimentally in critical candidate sites
Phenotypic analysis pipeline for At3g53850 mutants:
Advanced genetic manipulation:
Generate tissue-specific knockouts using cell type-specific promoters driving Cas9
Create conditional mutants using inducible CRISPR systems
Develop knock-in lines with specific point mutations to test the functional significance of conserved residues
Membrane interaction analysis methodology:
To investigate At3g53850 interactions with membrane components:
Biophysical approaches:
Fluorescence recovery after photobleaching (FRAP): Measure protein mobility within membranes to determine interaction dynamics
Detergent resistance analysis: Fractionate membranes to identify association with specialized domains like lipid rafts
Microscale thermophoresis: Quantify interactions between purified At3g53850 and specific lipids
Biochemical methods:
Crosslinking mass spectrometry: Identify proximal proteins and lipids in native membrane environments
Lipid overlay assays: Determine specific lipid binding preferences of At3g53850
Blue-native PAGE: Analyze native membrane protein complexes containing At3g53850
Imaging techniques:
Super-resolution microscopy (STORM, PALM): Visualize nanoscale organization of At3g53850 within membrane domains
Correlative light and electron microscopy (CLEM): Connect fluorescence localization with ultrastructural context
Computational approaches:
Molecular dynamics simulations: Model At3g53850 interactions with membrane lipids
Protein-lipid docking: Predict specific binding sites for membrane components
The effectiveness of these techniques has been demonstrated in studies of CASP proteins, where the formation of membrane domains and interaction with cell wall material has been characterized .
Several critical questions remain unanswered regarding At3g53850:
Developmental role beyond Casparian strip formation: While knockout studies of orthologous genes have shown altered growth dynamics, the specific developmental pathways influenced by At3g53850 remain poorly characterized . Future research should investigate whether At3g53850 regulates developmental transitions, cell differentiation, or organ formation.
Environmental response specificity: Although cold stress responses have been documented for orthologous CASP-like proteins, the full spectrum of environmental responses modulated by At3g53850 requires systematic investigation . Research should address whether At3g53850 responds to multiple abiotic stresses or has evolved specific functions in cold adaptation.
Tissue-specific functions: The broad expression pattern of CASP-like proteins suggests diverse roles across tissues, but tissue-specific functions remain largely unexplored . Cell type-specific knockout studies combined with transcriptomic analysis could reveal these specialized roles.
Evolutionary adaptation: The presence of CASP-like proteins across plant lineages with varying environmental adaptations suggests potential roles in evolutionary adaptation to different habitats . Comparative studies across species adapted to different environments could provide insights into functional specialization.
Protein interaction network: The full complement of proteins interacting with At3g53850 in different tissues and conditions remains undetermined. Interactome studies under various conditions could reveal context-specific protein complexes.
Strategies for resolving cross-species contradictions:
To reconcile contradictory findings across plant species:
Standardized experimental systems: Establish common experimental protocols and reporting standards to facilitate direct comparisons between studies on CASP-like proteins from different species.
Complementation studies: Express CASP-like proteins from different species in a common genetic background (e.g., Arabidopsis mutants) to directly test functional conservation or divergence.
Domain function analysis: Contradictions may stem from subtle differences in protein domains. Systematic domain swapping between orthologs can identify regions responsible for species-specific functions.
Context categorization: Analyze contradictory findings using a structured framework that considers factors such as:
Phylogenetic framework: Interpret functional differences in light of evolutionary relationships, considering that:
Closely related orthologs may have similar functions but different regulation
Distant orthologs may have undergone substantial functional divergence
Paralogs within a species may have evolved specialized functions
For example, contradictory findings regarding cold tolerance (AtCASPL4C1 knockout increasing tolerance while ClCASPL overexpression decreases tolerance) likely reflect species-specific adaptations that require integrated analysis across multiple experimental systems .
Emerging technologies for membrane domain research:
Several cutting-edge technologies show promise for advancing our understanding of At3g53850 function:
Advanced imaging approaches:
Expansion microscopy: Provides improved resolution of membrane domain organization
Lattice light-sheet microscopy: Enables long-term live-cell imaging with minimal phototoxicity
Cryo-electron tomography: Visualizes membrane proteins in native environments at near-atomic resolution
Single-cell multi-omics:
Single-cell proteomics: Reveals cell-specific protein expression patterns
Spatial transcriptomics: Maps gene expression to specific cells within intact tissues
Single-cell metabolomics: Connects At3g53850 function to metabolic changes at cellular resolution
Proximity labeling advances:
TurboID and miniTurbo: Faster biotin ligase variants for improved temporal resolution of protein interactions
Split-TurboID: Enables detection of protein-protein interactions with spatial precision
PerOxiSed: Organelle-specific proximity labeling for compartment-resolved interactomics
Synthetic biology approaches:
Optogenetic control of At3g53850 expression or localization
Engineered membrane domain systems to test At3g53850 function in defined contexts
CRISPR activation/interference for temporal control of gene expression
Computational methods:
Deep learning for image analysis of membrane domain organization
Integrative modeling combining structural, interactomic, and functional data
Network analysis approaches to place At3g53850 in broader cellular pathways
Implementation of these technologies will require interdisciplinary collaboration but promises to resolve longstanding questions about the precise mechanisms by which CASP-like proteins organize membrane domains and influence plant development and stress responses.