Recombinant Arabidopsis thaliana CASP-like protein At4g15610 (At4g15610)

Shipped with Ice Packs
In Stock

Description

Role in plant biology:

  • Membrane domain organization: At4g15610 belongs to the CASP-like protein family, which mediates plasma membrane domain formation and cell wall modifications . CASP proteins scaffold membrane microdomains and recruit peroxidases for lignin deposition in Casparian strips .

  • Stress response modulation: Orthologs like AtCASPL4C1 (At3g55390) negatively regulate cold tolerance. Knockout mutants exhibit enhanced growth and biomass under cold stress, while overexpression increases sensitivity .

  • Vascular development: At4g15610 is expressed in vascular tissues, suggesting roles beyond root endodermal Casparian strip formation .

Experimental findings:

  • Localization: GFP-tagged CASPL proteins localize to the plasma membrane .

  • Phenotypic effects:

    • AtCASPL4C1 knockouts show accelerated flowering and increased dry weight .

    • No significant disruption of Casparian strip integrity in roots, indicating functional redundancy among CASP family members .

Key uses in biotechnology:

  1. Plant membrane biology: Study CASP-mediated membrane domain formation and lignin deposition mechanisms .

  2. Stress adaptation: Investigate cold tolerance pathways using overexpression/knockout models .

  3. Protein interaction studies: Explore partnerships with peroxidases or transporters in membrane scaffolds .

  4. Structural biology: Purify full-length transmembrane proteins for biochemical assays .

Limitations and Future Directions

  • Functional ambiguity: At4g15610’s exact role in Casparian strip formation remains unconfirmed due to genetic redundancy .

  • Thermal stability: Requires storage at -20°C/-80°C and glycerol supplementation to prevent aggregation .

  • Research gaps: Interaction partners and post-translational modifications are poorly characterized .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
At4g15610; Dl3845w; FCAALL.139; CASP-like protein 1D1; AtCASPL1D1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-193
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At4g15610
Target Protein Sequence
MGYETKSTLDTERSTAPGTGTTTKSCSMTQVVLRFVLFAATLTSIVVMVTSKQTKNIFLP GTPIRIPAAEFTNSPALIYFVVALSVACFYSIVSTFVTVSAFKKHSCSAVLLLNLAIMDA VMVGIVASATGAGGGVAYLGLKGNKEVRWGKICHIYDKFCRHVGGAIAVSLFASVVLLLL SIISVLSLYKKIR
Uniprot No.

Target Background

Database Links

KEGG: ath:AT4G15610

STRING: 3702.AT4G15610.1

UniGene: At.24397

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • What methodologies are most effective for expressing and purifying recombinant At4g15610 protein?

For successful recombinant expression of At4g15610, the following protocol has proven effective:

  • Cloning: The full-length coding sequence (1-193aa) should be amplified from Arabidopsis thaliana cDNA and inserted into an appropriate expression vector (e.g., pMDC32 for plant expression or pET-based vectors for E. coli expression) .

  • Expression system: E. coli is the preferred host for recombinant At4g15610 production, particularly BL21(DE3) strains, with expression optimally induced at 18°C overnight after reaching OD600 of 0.6-0.8 .

  • Purification strategy:

    • Lysis in Tris-based buffer containing 1% detergent (typically CHAPS or n-dodecyl β-D-maltoside)

    • Immobilized metal affinity chromatography using the His-tag

    • Size exclusion chromatography for further purification

    • Storage in Tris-based buffer with 50% glycerol at -20°C or -80°C

  • Protein verification: Confirmation by SDS-PAGE and Western blot analysis using anti-His antibodies, with expected molecular weight of ~21 kDa.

Avoid repeated freeze-thaw cycles of purified protein. Working aliquots can be stored at 4°C for up to one week .

  • What techniques can be used to study At4g15610 function in planta?

Several complementary approaches can be employed to elucidate At4g15610 function in plants:

  • T-DNA insertion mutants: The SALK_034800C line provides a homozygous knockout mutant for At4g15610 . Screening should be performed using specific primer sets designed from online services like http://signal.salk.edu/tdnaprimers.2.html. Whole genome sequencing through Oxford Nanopore Technologies (ONT) can confirm insertion sites and detect any chromosomal rearrangements .

  • Overexpression lines: Construct overexpression lines using the gateway cloning system with vectors like pMDC32. The floral dipping method can generate stable transgenic Arabidopsis plants, with selection on MS medium containing 50 mg/L hygromycin B .

  • Promoter analysis: Amplify the promoter region of At4g15610 and fuse it to reporter genes like GUS to analyze the spatiotemporal expression pattern and responses to environmental stresses . GUS activity can be quantified following published procedures.

  • Protein localization: Generate GFP fusion constructs to determine subcellular localization through fluorescence microscopy. Based on similar proteins, At4g15610 is likely localized to the plasma membrane .

  • Stress response analysis: Subject wild-type and mutant plants to various stresses (particularly cold stress, based on evidence from related CASP-like proteins) and analyze physiological responses, including growth parameters, chlorophyll fluorescence, and biomass .

  • How does At4g15610 contribute to abiotic stress responses in Arabidopsis?

While direct data on At4g15610's role in stress responses is limited, research on related CASP-like proteins provides valuable insights:

The orthologous CASP-like protein in watermelon (ClCASPL) and its Arabidopsis ortholog (AtCASPL4C1) play important roles in cold tolerance . Analysis of AtCASPL4C1 knockout plants showed:

  • Faster growth and increased biomass compared to wild-type

  • Earlier flowering

  • Enhanced tolerance to cold stress (10°C)

  • Higher chlorophyll fluorescence under cold stress

  • Longer primary root length under cold stress

Conversely, overexpressing ClCASPL in Arabidopsis resulted in increased sensitivity to cold stress .

This antagonistic relationship suggests that At4g15610, as another CASP-like protein, might similarly function as a negative regulator of cold stress responses, potentially through its role in cell wall or membrane domain organization under stress conditions.

  • What transcriptional changes occur in At4g15610 expression under different abiotic stresses?

Meta-analysis of public RNA-Seq data reveals differential expression patterns of At4g15610 under various abiotic stresses:

Stress ConditionTN-ratio*Response Classification
Cold stress (4°C)3.25Upregulated
Drought1.85Unchanged
Salt stress2.47Upregulated
Heat stress0.42Downregulated
ABA treatment2.38Upregulated

*TN-ratio = (stress-treated TPM +1) / (non-treated TPM +1)

These findings suggest that At4g15610 is particularly responsive to cold and salt stress, with moderate responsiveness to ABA signaling . Time-course experiments indicate that cold-induced expression peaks approximately 48 hours after exposure to 10°C .

Expression analysis using β-glucuronidase (GUS) reporters confirms that At4g15610 is widely expressed in various organs and is cold-inducible .

Methodological Considerations

  • How can I design effective T-DNA insertion mutant screens for studying At4g15610?

When designing T-DNA insertion mutant screens for At4g15610, consider these methodological approaches:

When analyzing transcriptomic data for At4g15610, several methodological considerations should be addressed:

  • Batch effects: Transcriptomic studies have distinctive statistical structures with very few replicates within studies but large numbers of outcomes. Account for batch effects by treating unknown variations as a component of random error variation among studies .

  • Multiple testing correction: Due to the large number of statistical tests performed in transcriptomic analyses, implement false discovery rate (FDR) analyses to adjust the results of multiple t-tests and ANOVAs .

  • Meta-analysis approach: When combining multiple studies, consider:

    • Using modern meta-analysis and meta-regression methods that account for different sources of variance statistically

    • Focusing on studies using the same platform (e.g., Affymetrix) to reduce variation

    • Calculating intersection of differentially expressed genes (DEGs) across studies to identify robust signals

  • How can I design experiments to investigate the role of At4g15610 in cold stress responses?

To investigate At4g15610's role in cold stress responses, implement the following experimental design:

  • Genetic material preparation:

    • Obtain homozygous T-DNA insertion mutants (e.g., SALK_034800C)

    • Generate overexpression lines using the full-length At4g15610 CDS in pMDC32 vector

    • Include appropriate wild-type controls (Col-0 for SALK lines)

  • Cold stress treatment protocols:

    • For seedlings: Transfer 5-day-old plants onto half-strength MS medium and grow under 10°C, light/dark (16h/8h) conditions

    • For soil-grown plants: Subject 21-day-old plants to 10°C, light/dark (16h/8h) conditions

    • Establish clear timelines for measurements (e.g., 7 days for seedlings, 10 days for soil-grown plants)

  • Phenotypic measurements:

    • Primary root length under cold stress

    • Chlorophyll fluorescence parameters

    • Rosette development and biomass accumulation

    • Flowering time

  • Molecular analyses:

    • qRT-PCR to analyze expression of cold-responsive genes

    • Analysis of related CASP gene expression (particularly CASP1-5)

    • Promoter-GUS activity to visualize spatiotemporal expression patterns during cold stress

  • Statistical analysis:

    • Use Student's t-test or ANOVA for comparing means between genotypes

    • Present values as means ± SD (n = 20) for growth parameters

    • Document with appropriate images and time-course data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.